Clone Name | rbastl15d07 |
---|---|
Clone Library Name | barley_pub |
>CFTR_XENLA (P26363) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1485 Score = 31.2 bits (69), Expect = 1.1 Identities = 22/68 (32%), Positives = 33/68 (48%) Frame = -3 Query: 231 FIIQNLCTIAFITVPTCIAALYLILASCPAILVQNQKNTEEVLQPCMWCTLELIVLNACG 52 FI+ I F+ V A L++I + PAI + + +N EV TL +IV + Sbjct: 863 FILVFCLVIFFVEVAASSAWLWIIKRNAPAINMTSNENVSEVSD-----TLSVIVTHTSF 917 Query: 51 LYLRLIYV 28 Y+ IYV Sbjct: 918 YYVFYIYV 925
>CR2_MOUSE (P19070) Complement receptor type 2 precursor (Cr2) (Complement C3d| receptor) (CD21 antigen) Length = 1025 Score = 28.5 bits (62), Expect = 6.9 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -2 Query: 163 YFGKLSCDPSPESEKYRGSFATVYVVHT*IDRVEC 59 YF ++SCDP PE + R + ++ +V + R C Sbjct: 8 YFSEISCDPPPEVKNARKPYYSLPIVPGTVLRYTC 42
>WNK1_HUMAN (Q9H4A3) Serine/threonine-protein kinase WNK1 (EC 2.7.11.1)| (Protein kinase with no lysine 1) (Protein kinase, lysine-deficient 1) (Kinase deficient protein) Length = 2382 Score = 28.5 bits (62), Expect = 6.9 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +3 Query: 288 HFTAHFKPIGQPQDKLPTYLLELYSV 365 H AHF P+GQP LPT LL Y V Sbjct: 819 HSGAHFLPVGQP---LPTPLLPQYPV 841
>MATK_PHAAD (Q9MUZ5) Maturase K (Intron maturase)| Length = 511 Score = 28.5 bits (62), Expect = 6.9 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 304 KWAVKWQIMSSWLSFGFKWLKIC*IHYSKFVHHCFHNSAYL 182 KW KW +++ W F W++ IH ++ + CF YL Sbjct: 300 KW--KWYLINLWQYFFSFWIQPRRIHLNQLANSCFDFLGYL 338
>HAT1_DEBHA (Q6BSQ1) Histone acetyltransferase type B catalytic subunit (EC| 2.3.1.48) Length = 409 Score = 28.1 bits (61), Expect = 9.0 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -1 Query: 350 KKISR*LVLRLSDWFKMGGEVANHVKLAEFWFQ 252 KKIS+ +VL + K+GG N KL E+W Q Sbjct: 226 KKISQFIVLPMYQGLKLGGRFYN--KLYEYWMQ 256 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,624,922 Number of Sequences: 219361 Number of extensions: 1092101 Number of successful extensions: 2435 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2408 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2435 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)