Clone Name | rbastl15d05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TFDA_BURSR (Q45423) Alpha-ketoglutarate-dependent 2,4-dichloroph... | 30 | 2.0 | 2 | TFDA_RALEJ (P10088) Alpha-ketoglutarate-dependent 2,4-dichloroph... | 29 | 3.4 | 3 | LOX5_MESAU (P51399) Arachidonate 5-lipoxygenase (EC 1.13.11.34) ... | 28 | 4.5 |
---|
>TFDA_BURSR (Q45423) Alpha-ketoglutarate-dependent 2,4-dichlorophenoxyacetate| dioxygenase (EC 1.14.11.-) (2,4-D dioxygenase) Length = 297 Score = 29.6 bits (65), Expect = 2.0 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = -1 Query: 300 AVQVPGRPGRPLNHWNKMASQPCSTYAILLAATLLPSAGNTNF 172 A +V G L H + QP + Y++L A L PS G+T F Sbjct: 101 AREVVGNFANQLWHSDSSFQQPAARYSMLSAIVLPPSGGDTEF 143
>TFDA_RALEJ (P10088) Alpha-ketoglutarate-dependent 2,4-dichlorophenoxyacetate| dioxygenase (EC 1.14.11.-) (2,4-D dioxygenase) Length = 287 Score = 28.9 bits (63), Expect = 3.4 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -1 Query: 300 AVQVPGRPGRPLNHWNKMASQPCSTYAILLAATLLPSAGNTNF 172 A +V G L H + QP + Y++L A + PS G+T F Sbjct: 101 AREVVGNFANQLWHSDSSFQQPAARYSMLSAVVVPPSGGDTEF 143
>LOX5_MESAU (P51399) Arachidonate 5-lipoxygenase (EC 1.13.11.34)| (5-lipoxygenase) (5-LO) Length = 672 Score = 28.5 bits (62), Expect = 4.5 Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Frame = +2 Query: 65 KRLYNLPKVLPTYSETTAVSFSRH---EK*SQERNILTIKFVLPADGKSVAANRMAYVEH 235 KR LP+ LP +E S RH E+ QE NI + + L DG + AN+ H Sbjct: 245 KRCRELPQKLPVTTEMVECSLERHLSLEQEVQEGNIFIVDYEL-LDG--IDANKTDPCTH 301 Query: 236 GWLA 247 +LA Sbjct: 302 QFLA 305 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,945,566 Number of Sequences: 219361 Number of extensions: 828807 Number of successful extensions: 1953 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1953 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)