Clone Name | rbastl15c07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LON_BUCAP (Q8K988) ATP-dependent protease La (EC 3.4.21.53) | 30 | 1.8 | 2 | LON1_MYXXA (P36773) ATP-dependent protease La 1 (EC 3.4.21.53) | 29 | 2.3 | 3 | MG101_CANGA (Q6FK91) Mitochondrial genome maintenance protein MG... | 29 | 3.1 |
---|
>LON_BUCAP (Q8K988) ATP-dependent protease La (EC 3.4.21.53)| Length = 777 Score = 29.6 bits (65), Expect = 1.8 Identities = 11/40 (27%), Positives = 24/40 (60%) Frame = -3 Query: 206 LDDKEERRLPLPLRCCQDLLVVSHYDVPLFVIRNLTSYCV 87 ++ + R+ +P+ +D++V H +PLFV R + +C+ Sbjct: 1 MNSERSERIKIPVLPLRDVVVYPHMVIPLFVGRKKSIHCI 40
>LON1_MYXXA (P36773) ATP-dependent protease La 1 (EC 3.4.21.53)| Length = 817 Score = 29.3 bits (64), Expect = 2.3 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = -3 Query: 203 DDKEE---RRLPLPLRCCQDLLVVSHYDVPLFVIR 108 DDK+E R L +PL +D++V H VPLFV R Sbjct: 6 DDKKEAQKRGLTVPLLPLRDIIVFPHMVVPLFVGR 40
>MG101_CANGA (Q6FK91) Mitochondrial genome maintenance protein MGM101,| mitochondrial precursor Length = 244 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 170 LRCCQDLLVVSHYDVPLFVIRNLTSYCV*K 81 +RCC+DL + S P+F+ R T +CV K Sbjct: 188 MRCCKDLGIGSELWDPVFIKRFKTEHCVEK 217 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,480,016 Number of Sequences: 219361 Number of extensions: 426547 Number of successful extensions: 820 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 820 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)