Clone Name | rbastl15c03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HGFL_HUMAN (P26927) Hepatocyte growth factor-like protein precur... | 30 | 1.9 | 2 | TIS1_DROME (P47980) Protein TIS11 (dTIS11) | 29 | 5.4 | 3 | ACH10_RAT (Q9JLB5) Neuronal acetylcholine receptor protein, alph... | 28 | 9.2 |
---|
>HGFL_HUMAN (P26927) Hepatocyte growth factor-like protein precursor| (Macrophage stimulatory protein) (MSP) (Macrophage-stimulating protein) [Contains: Hepatocyte growth factor-like protein alpha chain; Hepatocyte growth factor-like protein beta chain] Length = 711 Score = 30.4 bits (67), Expect = 1.9 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = -3 Query: 240 LPCGAHSHRLFPVNSTGETPRLFRSMQENICQNKMRSP 127 LPC A SH+ FP N TP L ++EN C+N P Sbjct: 129 LPCQAWSHK-FP-NDHKYTPTLRNGLEENFCRNPDGDP 164
>TIS1_DROME (P47980) Protein TIS11 (dTIS11)| Length = 436 Score = 28.9 bits (63), Expect = 5.4 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 12/42 (28%) Frame = -3 Query: 426 HRQQPHRLHRG------------AHQDRRHLQWRRLSPAVAS 337 H+QQPHR H G Q ++H Q ++ PAVAS Sbjct: 59 HQQQPHRHHGGLTRTISQPAQLIQQQQQQHQQQQQQQPAVAS 100
>ACH10_RAT (Q9JLB5) Neuronal acetylcholine receptor protein, alpha-10 subunit| precursor (Nicotinic acetylcholine receptor subunit alpha 10) (NACHR alpha 10) Length = 447 Score = 28.1 bits (61), Expect = 9.2 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -3 Query: 408 RLHRGAHQDRRHLQWRRLSPAVASFNSSIFLC 313 R HR A RRH W+RL+ + F IF C Sbjct: 404 RSHRAAQ--RRHEDWKRLARVMDRFFLGIFFC 433 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,616,000 Number of Sequences: 219361 Number of extensions: 1208489 Number of successful extensions: 2895 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2895 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)