Clone Name | rbastl15c02 |
---|---|
Clone Library Name | barley_pub |
>COPB_RAT (P23514) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 31.2 bits (69), Expect = 0.62 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 404 KTQGIALSLGDKITLKQK 351 K+QG+ALSLGDKI L QK Sbjct: 932 KSQGMALSLGDKINLSQK 949
>COPB_MOUSE (Q9JIF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 31.2 bits (69), Expect = 0.62 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 404 KTQGIALSLGDKITLKQK 351 K+QG+ALSLGDKI L QK Sbjct: 932 KSQGMALSLGDKINLSQK 949
>COPB_HUMAN (P53618) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 31.2 bits (69), Expect = 0.62 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 404 KTQGIALSLGDKITLKQK 351 K+QG+ALSLGDKI L QK Sbjct: 932 KSQGMALSLGDKINLSQK 949
>COPB_DROME (P45437) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 964 Score = 29.3 bits (64), Expect = 2.3 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 404 KTQGIALSLGDKITLKQK 351 K+QG+ALSLGDKI+ QK Sbjct: 941 KSQGMALSLGDKISSSQK 958
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 29.3 bits (64), Expect = 2.3 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSRLFLHHRFLSKKASSWKGVGRDHCISRGH 160 + R+ PE ++L TPTQ F +HR+ +K+A + KG + GH Sbjct: 565 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGH 619
>HNK2_XENLA (P42587) Homeobox protein XENK-2| Length = 196 Score = 28.5 bits (62), Expect = 4.0 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSRLFLHHRFLSKKASSWKGV 130 + R+ PE ++L TPTQ F +HR+ K+A S KG+ Sbjct: 89 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARSEKGM 133
>NX22A_BRARE (Q90481) Homeobox protein Nkx-2.2a (Homeobox protein NK-2 homolog| B) Length = 269 Score = 28.1 bits (61), Expect = 5.2 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSRLFLHHRFLSKKASSWKGVGRDH 142 + R+ PE ++L TPTQ F +HR+ K+A + KG+ H Sbjct: 145 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTH 193
>RL1D1_PONPY (Q5RCE6) Ribosomal L1 domain-containing protein 1| Length = 490 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -2 Query: 244 NVQKIKERDEKRKVARKSVLRLKMDLQLVSSGDAMI 137 N +K KER +KR+ ARK+ L D SGD + Sbjct: 295 NFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTV 330
>RL1D1_HUMAN (O76021) Ribosomal L1 domain-containing protein 1 (Cellular| senescence-inhibited gene protein) (PBK1 protein) (CATX-11) Length = 490 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -2 Query: 244 NVQKIKERDEKRKVARKSVLRLKMDLQLVSSGDAMI 137 N +K KER +KR+ ARK+ L D SGD + Sbjct: 295 NFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTV 330
>CHMU_ARATH (P42738) Chorismate mutase, chloroplast precursor (EC 5.4.99.5)| (CM-1) Length = 334 Score = 27.7 bits (60), Expect = 6.8 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 351 GRQLSCDAICCNCVM*EVHFASFI 280 G CDAIC C+ +H+ F+ Sbjct: 207 GSTAVCDAICLQCLSKRIHYGKFV 230
>HISX_BLOFL (Q7VQX0) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 437 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 149 RCNDLSQLPSMMRPFLTKNGGVRIDVKFVL 60 RC+ QL + RP N + +DVK++L Sbjct: 14 RCSISEQLTLLTRPINKHNNSIHLDVKYIL 43
>SPTA2_CHICK (P07751) Spectrin alpha chain, brain (Spectrin, non-erythroid alpha| chain) (Fodrin alpha chain) Length = 2477 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 403 RLKELHSAWETRLPSSRREAVKL 335 RL+ELH WE L R + VKL Sbjct: 123 RLQELHRLWELLLEKMREKGVKL 145
>ATS10_HUMAN (Q9H324) ADAMTS-10 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 10) (ADAM-TS 10) (ADAM-TS10) (Fragment) Length = 1077 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = +2 Query: 62 TQTSRLFLHH---RFLSKKASSWKGVGRDHCISRGH 160 T++SRL H + +++ +W+ R HC+ GH Sbjct: 66 TRSSRLLAGHVSVEYWTREGLAWQRAARPHCLYAGH 101
>NKX22_MOUSE (P42586) Homeobox protein Nkx-2.2 (Homeobox protein NK-2 homolog B)| Length = 273 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSRLFLHHRFLSKKASSWKGV 130 + R+ PE ++L TPTQ F +HR+ K+A + KG+ Sbjct: 148 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGM 192
>NKX22_MESAU (P43697) Homeobox protein Nkx-2.2 (Homeobox protein NK-2 homolog B)| Length = 273 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSRLFLHHRFLSKKASSWKGV 130 + R+ PE ++L TPTQ F +HR+ K+A + KG+ Sbjct: 148 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGM 192
>NKX22_HUMAN (O95096) Homeobox protein Nkx-2.2 (Homeobox protein NK-2 homolog B)| Length = 273 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +2 Query: 8 KSMRH*KGPEIQYLNP----TPTQTSRLFLHHRFLSKKASSWKGV 130 + R+ PE ++L TPTQ F +HR+ K+A + KG+ Sbjct: 148 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGM 192 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,354,231 Number of Sequences: 219361 Number of extensions: 918705 Number of successful extensions: 2353 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2310 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2353 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)