>MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial)|
           (High molecular weight salivary mucin MG1) (Sublingual
           gland mucin)
          Length = 5703

 Score = 28.9 bits (63), Expect = 4.1
 Identities = 12/37 (32%), Positives = 19/37 (51%)
 Frame = +1

Query: 7   FHSPAKLSFNG*IIVHKWCSRVTNPHTSYITDSSTMN 117
           F  P  LS         WCSR+T+P++++    S +N
Sbjct: 605 FEDPCSLSVENENYARHWCSRLTDPNSAFSRCHSIIN 641


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,584,601
Number of Sequences: 219361
Number of extensions: 185503
Number of successful extensions: 393
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 393
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 393
length of database: 80,573,946
effective HSP length: 23
effective length of database: 75,528,643
effective search space used: 1812687432
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)