| Clone Name | rbastl15b03 |
|---|---|
| Clone Library Name | barley_pub |
>NOP14_SCHPO (O43051) Probable nucleolar complex protein 14| Length = 827 Score = 28.1 bits (61), Expect = 5.7 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 130 KHVLNTETKPRDQHSILCHQSEPLHSISKQGPS 228 +H+L+ +P +L H +E LHS+++Q PS Sbjct: 463 QHILHLTRQPMISMELLEHLTEHLHSLAQQFPS 495
>YIPK_SCHPO (Q9C111) Very hypothetical protein C343.20 in chromosome I| Length = 113 Score = 28.1 bits (61), Expect = 5.7 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +1 Query: 70 TVYSNTVICLHLRLRFIF*HKHVL 141 T +S+T+ C+H R+R+I+ +H L Sbjct: 26 TSHSSTIFCVHHRVRYIYVPRHCL 49
>JAK1_CYPCA (Q09178) Tyrosine-protein kinase Jak1 (EC 2.7.10.2) (Janus kinase| 1) (Jak-1) Length = 1156 Score = 28.1 bits (61), Expect = 5.7 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +1 Query: 73 VYSNTVICLHLRLRFIF*HKHVLNTETKPRDQHSILCHQSEPLHSISKQGP 225 + T I LH R+RF F + H P +HS+ H+ S+S +GP Sbjct: 96 ITEETSIKLHYRMRFYFTNWHAPVRTESPVWRHSLFKHKGV---SVSPKGP 143
>SPI6_SOLTU (Q41433) Probable serine protease inhibitor 6 precursor (AM66)| Length = 221 Score = 28.1 bits (61), Expect = 5.7 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +2 Query: 140 LIQRQNLGINILYCATKASRCIPYQSKDLLYLMEAIPNGYVKLQLHLL 283 ++Q G N+LYC ++ P+ S D L + + K +L L+ Sbjct: 161 IVQSSQFGYNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLALV 208
>SPI1_SOLTU (P58514) Serine protease inhibitor 1 precursor (PSPI-21)| (PSPI-21-6.3) [Contains: Serine protease inhibitor 1 chain A; Serine protease inhibitor 1 chain B] Length = 221 Score = 28.1 bits (61), Expect = 5.7 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +2 Query: 140 LIQRQNLGINILYCATKASRCIPYQSKDLLYLMEAIPNGYVKLQLHLL 283 +++ LG N+LYC ++ P+ S D L + + K +L L+ Sbjct: 161 IVKSSQLGYNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLALV 208
>MUS81_SCHPO (P87231) Crossover junction endonuclease mus81 (EC 3.1.22.-)| Length = 608 Score = 27.7 bits (60), Expect = 7.5 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 3/62 (4%) Frame = +1 Query: 64 FCTVYSNTVICLHL-RLRFIF*HKHVLN--TETKPRDQHSILCHQSEPLHSISKQGPSLS 234 +C +C+ L ++ F KH ++ + +K D S LC + SI+K G S Sbjct: 193 YCLTDDGEEVCIRLAKVDDSFQRKHTVSNFSVSKSDDHDSSLCQPPNFVTSINKAGSSSD 252 Query: 235 HG 240 HG Sbjct: 253 HG 254
>UN112_CAEEL (Q18685) Uncoordinated protein 112 (Mitogen-inducible mig-2| protein-like) Length = 720 Score = 27.3 bits (59), Expect = 9.8 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 196 PLHSISKQGPSLSHGSYSKRLRQTSAPPAISIGGG 300 P H +G S S G+Y+ +R+T P+IS G Sbjct: 214 PRHGTLPRGVSPSPGAYNDTMRRTPIMPSISFSEG 248
>INV4_YEAST (P10596) Invertase 4 precursor (EC 3.2.1.26)| (Beta-fructofuranosidase 4) (Saccharase) Length = 532 Score = 27.3 bits (59), Expect = 9.8 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = +1 Query: 130 KHVLNTETKPRDQHSILCHQSEPLHSISKQGPSLSHGSYSKRLRQTSAPPAISIGGGNI 306 K LNTE + + ++ ++EP+ +IS GP L S S + S +S G + Sbjct: 331 KFSLNTEYQANPETELINLKAEPILNISNAGPWLHFASNSTLTKANSFSVDLSNSTGTL 389 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,333,469 Number of Sequences: 219361 Number of extensions: 716820 Number of successful extensions: 1703 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1703 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)