| Clone Name | rbastl15a05 |
|---|---|
| Clone Library Name | barley_pub |
>CEAM1_RAT (P16573) Carcinoembryonic antigen-related cell adhesion molecule 1| precursor (Cell-CAM 105) (C-CAM 105) (Ecto-ATPase) (ATP-dependenttaurocolate-carrier protein) (GP110) (pp120) Length = 519 Score = 30.8 bits (68), Expect = 0.91 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 3/79 (3%) Frame = +3 Query: 21 YYHCHSRNR*TQDTAGSWMVNTDTTNNATYIHK---YLHQGSDHQLSIQARDKPWPWIFL 191 YY C +RN T + + + ++ +A I YLHQGS+ LS A P F Sbjct: 212 YYECEARNPATFNRSDPFNLDVIYGPDAPVISPPDIYLHQGSNLNLSCHADSNPPAQYFW 271 Query: 192 CQRANQPTSLHFLVVTTVT 248 TS L ++ +T Sbjct: 272 LINEKLQTSSQELFISNIT 290
>CP51_MYCVN (Q5IZM4) Cytochrome P450 51 (EC 1.14.13.70) (CYPLI) (P450-LIA1)| (Sterol 14-alpha demethylase) (Lanosterol 14-alpha demethylase) (P450-14DM) Length = 452 Score = 28.5 bits (62), Expect = 4.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -1 Query: 262 TNPLGVTVVTTRKCRDVGWFALWQRKI 182 T+P+G+ +C DVGWF L +++ Sbjct: 25 TDPIGLMKRVREECGDVGWFQLADKQV 51
>YFAL_ECOLI (P45508) Hypothetical protein yfaL precursor| Length = 1250 Score = 28.5 bits (62), Expect = 4.5 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +3 Query: 51 TQDTA---GSWMVNTDTTNNATYIHKYLHQGSDHQL 149 TQD + G W+V +D TNNA+ +L QG++ L Sbjct: 54 TQDWSIADGQWLVFSDMTNNASGGAVFLQQGAEFSL 89
>RPC1_BPD3 (Q37906) Repressor protein CI| Length = 223 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +3 Query: 36 SRNR*TQDTAGSWMVNTDTTNNATYIHKYLHQGSDHQLSIQAR 164 S R Q G+W++ +D + + Y + + S H+L I R Sbjct: 172 SIKRLNQQLTGAWLIRSDNPDKSAYPDEMASESSVHELPIIGR 214
>DUT_EBVA8 (Q07275) Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC| 3.6.1.23) (dUTPase) (dUTP pyrophosphatase) (Fragment) Length = 275 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +2 Query: 143 PIEHPSKGQALALDLSLPKSKPADVSTFPSSNYSNTQRV 259 PI HP + LD+SLPK D++ FP S T V Sbjct: 122 PINHPQYPGDVGLDVSLPK----DLALFPHQTVSVTLTV 156
>DUT_EBV (P03195) Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC| 3.6.1.23) (dUTPase) (dUTP pyrophosphatase) Length = 278 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +2 Query: 143 PIEHPSKGQALALDLSLPKSKPADVSTFPSSNYSNTQRV 259 PI HP + LD+SLPK D++ FP S T V Sbjct: 122 PINHPQYPGDVGLDVSLPK----DLALFPHQTVSVTLTV 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,510,813 Number of Sequences: 219361 Number of extensions: 861861 Number of successful extensions: 2064 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2020 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2062 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)