Clone Name | rbastl14g12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NINAG_DROME (Q9VGP2) Neither inactivation nor afterpotential pro... | 30 | 1.7 | 2 | WDR24_XENLA (Q7ZX22) WD-repeat protein 24 | 28 | 5.0 | 3 | DPO4_VIBPA (Q87MB4) DNA polymerase IV (EC 2.7.7.7) (Pol IV) | 28 | 8.4 |
---|
>NINAG_DROME (Q9VGP2) Neither inactivation nor afterpotential protein G| precursor (EC 1.-.-.-) Length = 581 Score = 30.0 bits (66), Expect = 1.7 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 79 NLHNHGGIPLSVKHGVTGPS 138 NLH+H +PL V GVTGP+ Sbjct: 307 NLHDHFNLPLFVSMGVTGPT 326
>WDR24_XENLA (Q7ZX22) WD-repeat protein 24| Length = 780 Score = 28.5 bits (62), Expect = 5.0 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +2 Query: 29 SLNFSTYDVSWPLMDDKIYIT--TEVYPYRLNMGSPA 133 SLNFS DV W MDD + T T N+G P+ Sbjct: 67 SLNFSCADVVWHQMDDNLLATAATNGVVVTWNLGKPS 103
>DPO4_VIBPA (Q87MB4) DNA polymerase IV (EC 2.7.7.7) (Pol IV)| Length = 354 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 29 SLNFSTYDVSWPLMDDKIYITTEVYPYRLNMGSP 130 S N STYD W ++++K+Y E RL SP Sbjct: 254 SQNISTYDECWQVIEEKLYPELE---KRLERASP 284 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,535,617 Number of Sequences: 219361 Number of extensions: 489045 Number of successful extensions: 924 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 924 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)