Clone Name | rbastl14g05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y4KT_RHISN (P55538) Hypothetical protein y4kT | 28 | 7.7 |
---|
>Y4KT_RHISN (P55538) Hypothetical protein y4kT| Length = 516 Score = 27.7 bits (60), Expect = 7.7 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = -2 Query: 169 HSAALPARFVCXXXXXXXXXGYCCKPLLHLYK*HVTWPFCIC 44 H A LP R C PLLH ++ TWP C Sbjct: 144 HPALLPLRQACLVKLGAVATLPSGHPLLHSWEAWGTWPTAAC 185 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,333,857 Number of Sequences: 219361 Number of extensions: 596081 Number of successful extensions: 1438 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1430 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)