Clone Name | rbastl14g03 |
---|---|
Clone Library Name | barley_pub |
>Y33A_METJA (P81306) Hypothetical protein MJ0332.1| Length = 132 Score = 28.9 bits (63), Expect = 3.5 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -2 Query: 134 YLNLLVAHLNFRMETLYYFSVMFDVLRVPVLMHNVLPFVVVY 9 YL L + + FS++F +L +PVL +P+V+ Y Sbjct: 27 YLKKLYQSMALTLAVFGIFSLLFFLLYIPVLSKKAVPYVINY 68
>SYM_MANSM (Q65S22) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA| ligase) (MetRS) Length = 686 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -2 Query: 137 GYLNLLVAHLNFRMETLYYFSVMFDVLRVPVLMHNVLPFVVVYS 6 GYL ++ L R E + +D L P+L H + PF ++S Sbjct: 488 GYLKPVLPKLAERSEAFLQAELTWDNLAQPLLNHGIAPFKALFS 531
>SMBP2_HUMAN (P38935) DNA-binding protein SMUBP-2 (EC 3.6.1.-) (ATP-dependent| helicase IGHMBP2) (Immunoglobulin mu-binding protein 2) (SMUBP-2) (Glial factor 1) (GF-1) Length = 993 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +2 Query: 179 SSQAWKEDGKNLSQQAGRARRISGQEASAPPASGR 283 S A K G S + G R+ GQEA+AP GR Sbjct: 660 SHAATKPQGPATSTRTGSQRQEGGQEAAAPARQGR 694
>PO23_POPJA (Q05118) Retrovirus-related Pol polyprotein from type-1| retrotransposable element R2 (Retrovirus-related Pol polyprotein from type I retrotransposable element R2) [Includes: Reverse transcriptase (EC 2.7.7.49); Endonuclease] (Fragment) Length = 606 Score = 28.1 bits (61), Expect = 6.0 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -1 Query: 279 PLAGGAEASWPEMRRALPACWLRFLPSSFQAWELHTQLK 163 PL GA WP R +P C + +P++ +A +HT LK Sbjct: 543 PLLLGARGIWP--RANVPTCNILSIPTTLRASCVHTCLK 579
>GLUB7_ORYSA (Q52PJ1) Glutelin type-B 7 precursor [Contains: Glutelin type-B 7| acidic chain; Glutelin type-B 7 basic chain] Length = 495 Score = 27.7 bits (60), Expect = 7.9 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 168 IVYEAPRLGRRTAK-ISASRQEEHGAFQARKLQRLQP 275 +V A R+ R A+ I +R EEHGAF R Q+ P Sbjct: 447 VVANAYRISREQARSIKNNRGEEHGAFTPRFQQQYYP 483
>GLUB2_ORYSA (Q02897) Glutelin type-B 2 precursor [Contains: Glutelin type-B 2| acidic chain; Glutelin type-B 2 basic chain] Length = 495 Score = 27.7 bits (60), Expect = 7.9 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 168 IVYEAPRLGRRTAK-ISASRQEEHGAFQARKLQRLQP 275 +V A R+ R A+ I +R EEHGAF R Q+ P Sbjct: 447 VVANAYRISREQARSIKNNRGEEHGAFTPRFQQQYYP 483 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,506,248 Number of Sequences: 219361 Number of extensions: 876366 Number of successful extensions: 2370 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2324 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2370 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)