ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl14f12 |
|---|---|
| Clone Library Name | barley_pub |
>UBPY_CAEEL (Q09931) Probable ubiquitin carboxyl-terminal hydrolase K02C4.3 (EC| 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin-specific processing protease) (Deubiquitinating enzyme) Length = 1302 Score = 29.6 bits (65), Expect = 2.0 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = -2 Query: 209 LKQIYGSCKPPRGRVSENFVGPV 141 + +++ S +PP+GR SE F+GP+ Sbjct: 101 INELFYSGEPPKGRKSERFIGPL 123
>ASPM_CANFA (P62286) Abnormal spindle-like microcephaly-associated protein| homolog (Fragment) Length = 3452 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +2 Query: 137 TKLDRQNFL--RLFLLAVYKTHIFVSVSGIFCSHLLFLQRHRLQAVIQTRY 283 TKL+R+ FL R + + + + I C H L ++RH+ +IQ + Sbjct: 2982 TKLERRRFLNVRASTIIIQRKWRAILSGRIACEHFLMIKRHQAACLIQANF 3032
>CD22_GORGO (Q9N1E4) B-cell receptor CD22 precursor (Siglec-2) (Fragment)| Length = 332 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 159 F*DSSSWRFTRPIYLFQCQESSVHICCFFRGTDSKL 266 F DSS W F P L+ + + V I C +R D L Sbjct: 18 FCDSSKWAFEHPETLYAWEGACVWIPCTYRALDGDL 53
>CD22_PONPY (Q9N1E3) B-cell receptor CD22 precursor (Siglec-2) (Fragment)| Length = 330 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 159 F*DSSSWRFTRPIYLFQCQESSVHICCFFRGTDSKL 266 F DSS W F P L+ + + V I C +R D L Sbjct: 16 FSDSSKWAFEHPETLYAWEGACVWIPCTYRALDGAL 51
>CD22_PANTR (Q9N1E6) B-cell receptor CD22 precursor (Siglec-2) (Fragment)| Length = 332 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 159 F*DSSSWRFTRPIYLFQCQESSVHICCFFRGTDSKL 266 F DSS W F P L+ + + V I C +R D L Sbjct: 18 FSDSSKWAFEHPETLYAWEGACVWIPCTYRALDRDL 53
>CD22_PANPA (Q9N1E5) B-cell receptor CD22 precursor (Siglec-2) (Fragment)| Length = 332 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 159 F*DSSSWRFTRPIYLFQCQESSVHICCFFRGTDSKL 266 F DSS W F P L+ + + V I C +R D L Sbjct: 18 FSDSSKWAFEHPETLYAWEGACVWIPCTYRALDRDL 53
>ASPM_AOTVO (P62283) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3473 Score = 28.5 bits (62), Expect = 4.5 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +2 Query: 137 TKLDRQNFLRLFLLAVYKTHIFVSV--SGIFCSHLLFLQRHRLQAVIQTRY 283 TKL+R FL L A+ + ++ + I H L +QRHR +IQ + Sbjct: 2986 TKLERTRFLNLRASAIIIQRKWRAILSAKIAHEHFLMIQRHRAACLIQAHF 3036
>CD22_HUMAN (P20273) B-cell receptor CD22 precursor (Leu-14) (B-lymphocyte cell| adhesion molecule) (BL-CAM) (Siglec-2) Length = 847 Score = 28.1 bits (61), Expect = 5.9 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 159 F*DSSSWRFTRPIYLFQCQESSVHICCFFRGTDSKL 266 F DSS W F P L+ + + V I C +R D L Sbjct: 18 FSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDL 53
>ASPM_PANTR (P62293) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3477 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 137 TKLDRQNFL--RLFLLAVYKTHIFVSVSGIFCSHLLFLQRHRLQAVIQTRY 283 TKL+R FL R + + + + + I H L ++RHR +IQ Y Sbjct: 2990 TKLERTRFLNVRASAIIIQRKWRAILSAKIAHEHFLMIKRHRAACLIQAHY 3040
>ASPM_HYLLA (P62290) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3477 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 137 TKLDRQNFL--RLFLLAVYKTHIFVSVSGIFCSHLLFLQRHRLQAVIQTRY 283 TKL+R FL R + + + + + I H L ++RHR +IQ Y Sbjct: 2990 TKLERTRFLNVRASAIIIQRKWRAILSAKIAHEHFLMIKRHRAACLIQAHY 3040
>ASPM_HUMAN (Q8IZT6) Abnormal spindle-like microcephaly-associated protein| (Abnormal spindle protein homolog) (Asp homolog) Length = 3477 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 137 TKLDRQNFL--RLFLLAVYKTHIFVSVSGIFCSHLLFLQRHRLQAVIQTRY 283 TKL+R FL R + + + + + I H L ++RHR +IQ Y Sbjct: 2990 TKLERTRFLNVRASAIIIQRKWRAILPAKIAHEHFLMIKRHRAACLIQAHY 3040
>ASPM_GORGO (P62289) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3476 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 137 TKLDRQNFL--RLFLLAVYKTHIFVSVSGIFCSHLLFLQRHRLQAVIQTRY 283 TKL+R FL R + + + + + I H L ++RHR +IQ Y Sbjct: 2989 TKLERTRFLNVRASAIIIQRKWRAILSAKIAHEHFLMIKRHRAACLIQAHY 3039
>ASPM_PONPY (P62294) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3471 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 137 TKLDRQNFL--RLFLLAVYKTHIFVSVSGIFCSHLLFLQRHRLQAVIQTRY 283 TKL+R FL R + + + + + I H L ++RHR +IQ Y Sbjct: 2984 TKLERTRFLNVRASAIIIQRKWRAILSAKIAHEHFLMIKRHRATCLIQAHY 3034 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,298,178 Number of Sequences: 219361 Number of extensions: 808317 Number of successful extensions: 1512 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1496 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1512 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
