Clone Name | rbastl14e12 |
---|---|
Clone Library Name | barley_pub |
>ARODE_CHLMU (P56961) Shikimate biosynthesis protein aroDE [Includes:| 3-dehydroquinate dehydratase (EC 4.2.1.10) (3-dehydroquinase) (Type I DHQase); Shikimate dehydrogenase (EC 1.1.1.25)] Length = 478 Score = 29.3 bits (64), Expect = 2.6 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 77 LHTSLHFHLTPI*TARLAATLSYFHTSVAPS 169 LHTS H +T + T LA+++ Y+ +V+P+ Sbjct: 109 LHTSEHTDITQLYTQMLASSIDYYKLAVSPA 139
>JHD1B_XENLA (Q640I9) JmjC domain-containing histone demethylation protein 1B (EC| 1.14.11.-) (F-box/LRR-repeat protein 10) (F-box and leucine-rich repeat protein 10) Length = 1259 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -2 Query: 267 SSKPTPR*VLSPPTSLEPPVSQPRQRRVLHP 175 S K TPR PP SL PP +R V+ P Sbjct: 938 SLKTTPRANNRPPPSLSPPKCMQMERHVIRP 968
>DAPF_NEIMA (Q9JV69) Diaminopimelate epimerase (EC 5.1.1.7) (DAP epimerase)| Length = 283 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -1 Query: 250 KMSALSSDFLRASGITAETATGSPPIRGWSDRSMEIG 140 KM L +DF+ ++ + PI W+DR +G Sbjct: 8 KMHGLGNDFMVIDAVSQDFTPEDAPIAAWADRFRGVG 44
>LIN1_NYCCO (P08548) LINE-1 reverse transcriptase homolog| Length = 1260 Score = 27.7 bits (60), Expect = 7.6 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = +2 Query: 38 EQGSNRSFVRMPQLHTSLHFHLTPI*TARLAATLSYFHTSVAPSPYGWRTRRCLGCDTGG 217 ++ S+ +R Q+ T+L +HLTP+ A H + +P+ WR GC G Sbjct: 1092 KKSSSSLIIREMQIKTTLRYHLTPVRVA---------HITKSPNQRCWR-----GCGGKG 1137 Query: 218 S 220 + Sbjct: 1138 T 1138
>CEP76_HUMAN (Q8TAP6) Centrosomal protein of 76 kDa (Cep76 protein)| Length = 659 Score = 27.3 bits (59), Expect = 9.9 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = -2 Query: 309 WVAKCGEDNC*KHISSKPTPR*VLSPPTSLEPPVSQPRQRRVLHPY 172 WV CG D S R + P EPPV++ Q + L+PY Sbjct: 410 WVMTCGTDGAITFWESLTGHRYIHKPTNPDEPPVAE--QPKPLYPY 453 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,025,546 Number of Sequences: 219361 Number of extensions: 882643 Number of successful extensions: 2265 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2265 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)