| Clone Name | rbastl14e09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ADRL_SCHPO (Q09749) ADIPOR-like receptor spbc12c2.09c | 30 | 1.6 | 2 | PHP_DROME (P39769) Polyhomeotic-proximal chromatin protein | 30 | 2.1 | 3 | LUMI_ARATH (Q38796) Homeobox protein LUMINIDEPENDENS | 29 | 2.8 | 4 | CDN1B_CANFA (Q6SLL5) Cyclin-dependent kinase inhibitor 1B (Cycli... | 28 | 4.8 |
|---|
>ADRL_SCHPO (Q09749) ADIPOR-like receptor spbc12c2.09c| Length = 324 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = +1 Query: 61 TWNIHRPWQE----AVNKYGSPGFQTIQCPKSVSHETNGSYSMY 180 TW+ PWQ+ ++ Y P F C KS+ H N S +++ Sbjct: 50 TWDQLEPWQQDNQYIISGYRPPSFSFYLCVKSIFHVHNESVNIW 93
>PHP_DROME (P39769) Polyhomeotic-proximal chromatin protein| Length = 1589 Score = 29.6 bits (65), Expect = 2.1 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 4/69 (5%) Frame = +3 Query: 42 RRYVQINMEHSQALAGSSQQIWLAG----LSNHPMSQKCISRNKWVLQYVQSKQKKGKVS 209 ++ Q +H QALA ++QQI +++H Q+ N+ + Q +Q +Q + +V Sbjct: 853 QQVAQAQAQHQQALANATQQILQVAPNQFITSHQQQQQQQLHNQLIQQQLQ-QQAQAQVQ 911 Query: 210 WQAVAVSQQ 236 Q A +QQ Sbjct: 912 AQVQAQAQQ 920
>LUMI_ARATH (Q38796) Homeobox protein LUMINIDEPENDENS| Length = 953 Score = 29.3 bits (64), Expect = 2.8 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +3 Query: 42 RRYVQINMEHSQALAGSSQQIWLAGLS--NHPMSQKCISRNKWVLQYVQSKQKK 197 RR VQ+ + Q AG S Q G S + PMS I + K Y+QSK K Sbjct: 397 RRKVQMVEQPGQKAAGKSPQTVRIGTSGRSRPMSADDIQKAKMRALYMQSKNSK 450
>CDN1B_CANFA (Q6SLL5) Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent| kinase inhibitor p27) (p27Kip1) Length = 198 Score = 28.5 bits (62), Expect = 4.8 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +3 Query: 117 LSNHPMSQKCISRNKWVLQYVQSKQKKGKVSWQAV 221 L H + + S+NKW + K +GK WQ V Sbjct: 45 LEKHCIDMEEASQNKWNFDFQNHKPLEGKYEWQEV 79 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,193,091 Number of Sequences: 219361 Number of extensions: 798327 Number of successful extensions: 2143 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2143 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)