Clone Name | rbastl14e08 |
---|---|
Clone Library Name | barley_pub |
>POLG_EBHSG (Q96725) Genome polyprotein [Contains: p16; p23; Helicase (2C-like| protein) (P2C); 3A-like protein; Viral genome-linked protein (VPg); Thiol protease P3C (EC 3.4.22.-); RNA-directed RNA polymerase (EC 2.7.7.48); Capsid protein VP60, subgenomic Length = 2334 Score = 30.4 bits (67), Expect = 1.2 Identities = 28/94 (29%), Positives = 40/94 (42%), Gaps = 27/94 (28%) Frame = -1 Query: 223 RCSDPL------VVLALHNCYLSETGDMLSLMDPTDLLYDIVSCLTDRACLLPFGVR--- 71 + SDPL +++ALHNC +T MLS P +LL ++ D L +R Sbjct: 261 KLSDPLKTLAAILLVALHNCVAVDTTTMLSHFKPVNLLAILLDWTNDLPGFLTTLIRFME 320 Query: 70 --------LNLGVN----------IAAQRCCMLL 23 +NL V+ A +RCC LL Sbjct: 321 LYGVVQSTVNLVVDAIKSFWDRVMCATERCCDLL 354
>GLN3_YEAST (P18494) Nitrogen regulatory protein GLN3| Length = 730 Score = 30.0 bits (66), Expect = 1.5 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +3 Query: 18 NNNNMQQRWAAILTPKFRRTPKGSKQARSVRQLTISYKRSVGSIRESMSPVS 173 N+NN+ + + +TP FRR+ + S + + + S RSV I SP S Sbjct: 460 NSNNLMRHNSNTVTPNFRRSSRRSSTSSNTSSSSKSSSRSVVPILPKPSPNS 511
>UBE1L_HUMAN (P41226) Ubiquitin-activating enzyme E1 homolog (D8)| Length = 1011 Score = 30.0 bits (66), Expect = 1.5 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = -1 Query: 229 SGRCSDPLVVLALHNCYLSETGDMLSLMDPTD--LLYDIVSCLTDRACLLP 83 S RC +P+V + +C S G++ M P D L +D + CL + LLP Sbjct: 353 SARCLEPMVACWVSSCPGSAEGNLQKFM-PLDQWLYFDALDCLPEDGELLP 402
>RPOL_KLULA (P05472) Probable DNA-directed RNA polymerase (EC 2.7.7.6) (Killer| plasmid PGKL2 protein 6) Length = 982 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +3 Query: 102 SVRQLTISYKRSVGSIRESMSPVSDK*QLCKARTTSGSL 218 S+R++TI RS ++E +DK ++C +T+ GSL Sbjct: 244 SIRRITIPSSRSNAPMKERRVEDNDKYKICPIQTSDGSL 282
>DRS1_YARLI (Q6CEB8) ATP-dependent RNA helicase DRS1 (EC 3.6.1.-)| Length = 753 Score = 29.6 bits (65), Expect = 2.0 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = +2 Query: 32 ATTLGGNINT*IQ---ANPKR*QTGSVSQAANYIIQEVCRIHKREHVTCFRQVTIVQSKD 202 + T+ +I++ IQ + P R QAA+ ++QE RI KR+H+ +I++ D Sbjct: 437 SATMNSSISSLIQLSLSRPVRVMINPPKQAASGLVQEFVRIRKRDHLKPALLASILKKMD 496
>YIS3_YEAST (P40563) Protein YIR003W| Length = 679 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -3 Query: 317 SQGPPANDVGNRKATNEELLDATE 246 SQ P N VGNRKA +EE L +E Sbjct: 605 SQLPQTNAVGNRKAISEESLSPSE 628
>YDVG_SCHPO (O14232) Putative helicase C6F12.16c (EC 3.6.1.-)| Length = 1117 Score = 27.7 bits (60), Expect = 7.5 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 1/87 (1%) Frame = +3 Query: 63 KFRRTPKGSKQARSVRQLTISYKRSVGSIRESMSPVSDK*QLCKARTT-SGSLHRPDFF* 239 + + K SKQ + + S+K S+ + + + + Q+CK GSL R Sbjct: 1016 RIAKVSKESKQELNEEEYVNSFKPSLMEVVYAWAHGASFAQICKMTDVYEGSLIR----- 1070 Query: 240 STFRGIEELLVCRLSVADVVGGRTLRR 320 FR +EEL+ + A V+G +L++ Sbjct: 1071 -MFRRLEELIRQMVDAAKVIGNTSLQQ 1096
>ADT_KLULA (P49382) ADP,ATP carrier protein (ADP/ATP translocase) (Adenine| nucleotide translocator) (ANT) Length = 305 Score = 27.3 bits (59), Expect = 9.8 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 145 P*ERACHLFQTSNNCAKQGQLAGRYTGLI 231 P ER L Q + KQG L RYTG++ Sbjct: 30 PIERVKLLIQNQDEMIKQGSLDRRYTGIV 58 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,029,139 Number of Sequences: 219361 Number of extensions: 851347 Number of successful extensions: 1836 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1836 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)