Clone Name | rbastl14e06 |
---|---|
Clone Library Name | barley_pub |
>PYRB_BACTN (Q8A9S3) Aspartate carbamoyltransferase (EC 2.1.3.2) (Aspartate| transcarbamylase) (ATCase) Length = 313 Score = 30.4 bits (67), Expect = 1.2 Identities = 18/69 (26%), Positives = 36/69 (52%) Frame = -1 Query: 246 CRNDFPKFRKHTEQKGTTEDNIEKESLKHMILIRRGKLNLQVEYVSIRK*LLLPNVILQM 67 C+ K+ +HTE TE+ I + +M ++R + +EY ++ +L N +L+ Sbjct: 196 CKEHQIKYIEHTE---FTEEIIADADILYMTRVQRERFTDLMEYERVKNVYILRNKMLEN 252 Query: 66 TKLTVNILY 40 T+ + IL+ Sbjct: 253 TRPNLRILH 261
>YCF2_MARPO (P09975) Protein ycf2| Length = 2136 Score = 30.0 bits (66), Expect = 1.6 Identities = 13/42 (30%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +2 Query: 110 LTYSTCKFNFPRLIRIICFRLSFSILSSV-VPFCSVCFLNLG 232 LTY+ K NF R+ +I+ +++ +I+ ++ + S+ LN+G Sbjct: 1623 LTYTNNKLNFDRIFKIVIYKVGKTIIQNILIKSSSMNLLNIG 1664
>PUB2_SCHPO (Q9UTG2) E3 ubiquitin--protein ligase pub2 (EC 6.3.2.-)| Length = 671 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/42 (26%), Positives = 26/42 (61%) Frame = -1 Query: 279 YAKVEGLVPERCRNDFPKFRKHTEQKGTTEDNIEKESLKHMI 154 + K+E L P++ + F +F + + K + + N+E + +KH++ Sbjct: 183 HEKLENLTPKQLKEVFSQFLFNNQSKSSLKINLEYKVIKHLL 224
>YIF1A_BRARE (Q6PC24) Protein YIF1A (YIP1-interacting factor homolog A)| Length = 307 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 65 VICKITLGSNSYFLILTYSTCKFNFPRLIRIICFRLSFSILSSV 196 V C + GS+ Y++ L +S+C F I L ILSS+ Sbjct: 229 VFCGLLFGSDGYYVALAWSSCALMF-----FIVRSLKMKILSSI 267
>ULA1_SCHPO (Q9UT93) NEDD8-activating enzyme E1 regulatory subunit| (Ubiquitin-like activation protein 1) (Ubiquitin-activating enzyme E1-like 1) Length = 500 Score = 28.1 bits (61), Expect = 6.0 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 4/58 (6%) Frame = -1 Query: 282 QYAKVEGLVPERCRNDFPKFRKHTEQK----GTTEDNIEKESLKHMILIRRGKLNLQV 121 QY K++ + E+ ND KF+K+ +Q + + I +KH R LN++V Sbjct: 325 QYVKLQVIYKEKSENDILKFKKYVQQTLKRLNRSVEEITDLEIKH---FSRNCLNIKV 379
>CYAA_SACKL (P23466) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase)| (Adenylyl cyclase) Length = 1839 Score = 28.1 bits (61), Expect = 6.0 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 288 RDQYAKVEGLVPERCRNDFPKFRKHTEQKGTTEDNIEKE 172 R+++ ++E E N PKF+KH TT N E + Sbjct: 14 REKHPQIEETFEEHVHNAMPKFKKHYALGITTHTNDEDD 52
>PPCK_RHOPA (Q9ZNH4) Phosphoenolpyruvate carboxykinase [ATP] (EC 4.1.1.49) (PEP| carboxykinase) (Phosphoenolpyruvate carboxylase) (PEPCK) Length = 537 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -1 Query: 288 RDQYAKVEGLVPERCRNDFPKFRKHTEQKGTTEDNI 181 R + A++E VPE D P FR ++ G +N+ Sbjct: 143 RPERAELENFVPELTLIDLPSFRADPKRHGCRSENV 178 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,602,860 Number of Sequences: 219361 Number of extensions: 699049 Number of successful extensions: 1721 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1721 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)