Clone Name | rbastl14e04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, trac... | 30 | 2.1 | 2 | FREM1_HUMAN (Q5H8C1) FRAS1-related extracellular matrix protein ... | 29 | 3.7 | 3 | IMMC_ECOLI (P02986) Cloacin immunity protein | 29 | 3.7 | 4 | Y1742_STRPN (Q97P99) UPF0348 protein SP1742 | 28 | 8.2 | 5 | Y1587_STRR6 (Q8DNR1) UPF0348 protein spr1587 | 28 | 8.2 |
---|
>MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial)| (High molecular weight salivary mucin MG1) (Sublingual gland mucin) Length = 5703 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 4 RMQFHSPARLSFNGWIRVHKWCSRVTNPHTSYITDSSTMN 123 R F P LS WCSR+T+P++++ S +N Sbjct: 602 RNSFEDPCSLSVENENYARHWCSRLTDPNSAFSRCHSIIN 641
>FREM1_HUMAN (Q5H8C1) FRAS1-related extracellular matrix protein 1 precursor| (QBRICK protein) Length = 2179 Score = 28.9 bits (63), Expect = 3.7 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 42 WVDQSSQMVFEGNQPPHKLHNRLKHDELLFKLYKF 146 W D S + QPP+ H+ +HDE+ ++Y F Sbjct: 360 WKDLSDMQI--AYQPPNSSHSERRHDEVELEVYDF 392
>IMMC_ECOLI (P02986) Cloacin immunity protein| Length = 85 Score = 28.9 bits (63), Expect = 3.7 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 40 NGWIRVHKWCSRVTNPHTSYITDSSTMNYFLSSI 141 NGW V K + PH + D S +YF+S + Sbjct: 46 NGWFDVEKPWVSILQPHFKNVIDISKFDYFVSFV 79
>Y1742_STRPN (Q97P99) UPF0348 protein SP1742| Length = 365 Score = 27.7 bits (60), Expect = 8.2 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 3 PNAVSFPCKTELQWVDQSSQMVFEGNQPPHKL 98 P+++S+P KT+ W + + + F GN P H L Sbjct: 125 PDSLSYPQKTQAMW-KEFAGLDFSGNTPNHVL 155
>Y1587_STRR6 (Q8DNR1) UPF0348 protein spr1587| Length = 365 Score = 27.7 bits (60), Expect = 8.2 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 3 PNAVSFPCKTELQWVDQSSQMVFEGNQPPHKL 98 P+++S+P KT+ W + + + F GN P H L Sbjct: 125 PDSLSYPQKTQAMW-KEFAGLDFSGNTPNHVL 155 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,770,155 Number of Sequences: 219361 Number of extensions: 389656 Number of successful extensions: 1088 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1081 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1087 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)