Clone Name | rbastl14d11 |
---|---|
Clone Library Name | barley_pub |
>LONH2_MAIZE (P93648) Lon protease homolog 2, mitochondrial precursor (EC| 3.4.21.-) Length = 964 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/20 (70%), Positives = 17/20 (85%), Gaps = 2/20 (10%) Frame = -2 Query: 309 DTYNEIYKLAFQNE--TETS 256 DTY+EIY LAFQ++ TETS Sbjct: 945 DTYSEIYDLAFQSDAGTETS 964
>ASB5_MOUSE (Q9D1A4) Ankyrin repeat and SOCS box protein 5 (ASB-5)| Length = 329 Score = 28.1 bits (61), Expect = 5.9 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +2 Query: 17 FEQTSSFSYFT*LLNYLATDILVKISLNILSHGTLGKNN 133 F Q S YFT +L+ + VKISL ILSH + K N Sbjct: 10 FAQQLSNVYFT-ILSLFCFKLFVKISLAILSHFYIVKGN 47
>ASB5_HUMAN (Q8WWX0) Ankyrin repeat and SOCS box protein 5 (ASB-5)| Length = 329 Score = 28.1 bits (61), Expect = 5.9 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +2 Query: 17 FEQTSSFSYFT*LLNYLATDILVKISLNILSHGTLGKNN 133 F Q S YFT +L+ + VKISL ILSH + K N Sbjct: 10 FAQQLSNVYFT-ILSLFCFKLFVKISLAILSHFYIVKGN 47
>AMPA_MYCPA (Q73YK2) Probable cytosol aminopeptidase (EC 3.4.11.1) (Leucine| aminopeptidase) (LAP) (Leucyl aminopeptidase) Length = 515 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 168 EWPSCKLRSVFSLAPKTLRNLNTLFELLASL 260 EWP+ +R +A ++L N T+F LA+L Sbjct: 100 EWPADTVRRAAGVAARSLSNTETVFTTLAAL 130
>CXCR2_BOVIN (Q28003) High affinity interleukin-8 receptor B (IL-8R B) (CXCR-2)| (CD182 antigen) Length = 360 Score = 27.7 bits (60), Expect = 7.7 Identities = 18/63 (28%), Positives = 30/63 (47%) Frame = -1 Query: 214 FGARLNTERSLQLGHSLQDQE*LFVVMIVFS*CPM*QYV*GNFDENVRG*IVEELCEIRK 35 +G L T S Q+GH + +F V++VF C + + D +R ++ E C+ R Sbjct: 231 YGFTLRTLFSAQMGHKHRAMRVIFAVVLVFLLCWLPYNLVLIADTLMRAHVIAETCQRRN 290 Query: 34 TRG 26 G Sbjct: 291 DIG 293
>PIN2_CAEEL (Q19157) LIM protein pin-2| Length = 329 Score = 27.3 bits (59), Expect = 10.0 Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 5/57 (8%) Frame = -3 Query: 266 QKQASKQFKQSIQIAQGLWGKTEYGTKFAARPFFA-----RSGVTFCCNDCFFLVSH 111 +K Q +QSI W + ARPFF ++G +C +D L+ H Sbjct: 205 KKVIDPQVEQSIFTMNKHWHTDHFRCATCARPFFGHEHYEKNGKAYCRDDFLELIGH 261 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,932,395 Number of Sequences: 219361 Number of extensions: 628409 Number of successful extensions: 1509 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1509 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)