Clone Name | rbastl14d09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LIPA_RHOBA (Q7UH37) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid sy... | 28 | 6.1 | 2 | GUAA_ANASP (Q8YT80) GMP synthase [glutamine-hydrolyzing] (EC 6.3... | 28 | 6.1 | 3 | YMA2_YEAST (Q04263) Hypothetical 84.6 kDa protein in GLO1-YPT7 i... | 28 | 8.0 |
---|
>LIPA_RHOBA (Q7UH37) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 316 Score = 28.1 bits (61), Expect = 6.1 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 77 HNSLLALRQNKGNATRVLSPN-VHKRIPTLRVIHI*RKMMLHHPHSIKGL 223 HN ++A+R+ G T VL+P+ VH + RVI + H+ ++ L Sbjct: 149 HNCVIAVRERTGATTEVLTPDFVHCKEALARVIEAKPTVFNHNMETVPRL 198
>GUAA_ANASP (Q8YT80) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 540 Score = 28.1 bits (61), Expect = 6.1 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = -3 Query: 256 VIICHGSIIKPQPLDRMRVVQHHFSLDVDYTKGRNSFVDVWRQNSSGIT 110 V I G + K +P +++ Q F + V+Y R+ F+D+ SG+T Sbjct: 267 VFIDQGFMRKYEPERLVKLFQEQFHIPVEYVNARDRFLDI----MSGVT 311
>YMA2_YEAST (Q04263) Hypothetical 84.6 kDa protein in GLO1-YPT7 intergenic| region Length = 737 Score = 27.7 bits (60), Expect = 8.0 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 205 RVVQHHFSLDVDYTKGRNSFVDVWRQNSSGIT 110 R V H+ + ++D K +++D R+NSSG T Sbjct: 211 RTVAHYLTHEMDILKSIGNYIDWKRKNSSGQT 242 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,996,150 Number of Sequences: 219361 Number of extensions: 792243 Number of successful extensions: 2143 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2143 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)