Clone Name | rbastl14d08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DPO4_VIBPA (Q87MB4) DNA polymerase IV (EC 2.7.7.7) (Pol IV) | 28 | 5.1 | 2 | BGAL_BACST (P19668) Beta-galactosidase 1 (EC 3.2.1.23) (Beta-gal... | 28 | 8.7 |
---|
>DPO4_VIBPA (Q87MB4) DNA polymerase IV (EC 2.7.7.7) (Pol IV)| Length = 354 Score = 28.5 bits (62), Expect = 5.1 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 59 SLNFSTYDVSWSLMDDKIYISTEVYAYRLNMVSP 160 S N STYD W ++++K+Y E RL SP Sbjct: 254 SQNISTYDECWQVIEEKLYPELE---KRLERASP 284
>BGAL_BACST (P19668) Beta-galactosidase 1 (EC 3.2.1.23) (Beta-galactosidase I)| (Lactase) Length = 672 Score = 27.7 bits (60), Expect = 8.7 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 17 KAQNLTKQNWPTVLSLNFSTYDVSWSLMDDKIY 115 + Q W ++ +N + Y+V+ SL +DKIY Sbjct: 607 EVQQRETDEWKYLIIINHNDYEVTLSLPEDKIY 639 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,820,683 Number of Sequences: 219361 Number of extensions: 350138 Number of successful extensions: 782 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)