Clone Name | rbastl14d01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | INO80_NEUCR (Q872I5) Putative DNA helicase ino-80 (EC 3.6.1.-) | 30 | 1.8 | 2 | KN1_MAIZE (P24345) Homeotic protein knotted-1 | 30 | 3.1 | 3 | MTRM_DROYA (P83733) Protein matrimony (Cell cycle arrest protein... | 28 | 9.0 | 4 | CR023_HUMAN (Q8NB54) Protein C18orf23 | 28 | 9.0 |
---|
>INO80_NEUCR (Q872I5) Putative DNA helicase ino-80 (EC 3.6.1.-)| Length = 2001 Score = 30.4 bits (67), Expect = 1.8 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 3/61 (4%) Frame = +1 Query: 115 SYRHSAQHHYPDTRHIAHTHMIPPWTSN*SSTQTEPSIQPSLGMPLVVQ---SLELGVSG 285 S +H QHH+P+ A +PP SS Q P+I P G+ SL L G Sbjct: 176 SQQHQQQHHHPNPFVAASAPSLPPPP---SSLQAPPAITPIAGLSAPAPASGSLPLSAGG 232 Query: 286 I 288 I Sbjct: 233 I 233
>KN1_MAIZE (P24345) Homeotic protein knotted-1| Length = 359 Score = 29.6 bits (65), Expect = 3.1 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = +1 Query: 91 QHF*TCKHSYRHS-AQHHYPDTRHIAHTHMIPPWTSN*SSTQTE-PSIQPSLGMPLVVQS 264 QHF S+ H QHH+ H H PW S+ S+ P PS G+PL + + Sbjct: 6 QHFGVGASSHGHGHGQHHH-------HHHHHHPWASSLSAVVAPLPPQPPSAGLPLTLNT 58 Query: 265 L 267 + Sbjct: 59 V 59
>MTRM_DROYA (P83733) Protein matrimony (Cell cycle arrest protein D52)| Length = 219 Score = 28.1 bits (61), Expect = 9.0 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 112 HSYRHSAQHHYPDTRHIAHTHMIPP 186 H + H QHH+ +HI T + PP Sbjct: 79 HPHPHQHQHHHHHHKHIHRTQLKPP 103
>CR023_HUMAN (Q8NB54) Protein C18orf23| Length = 160 Score = 28.1 bits (61), Expect = 9.0 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -2 Query: 226 CWVPFAYCFSYSSREESCVCGRYALYQDNGVVRCACSCVCTF 101 C P YC ++ + +C+C A + C C CVC + Sbjct: 26 CASPLCYCPAHPA-PRNCLCMTVAYTGSRCLGACVCVCVCLY 66 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,659,226 Number of Sequences: 219361 Number of extensions: 1055880 Number of successful extensions: 3072 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2901 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3044 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)