Clone Name | rbastl14c06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AMY1_ORYSA (P17654) Alpha-amylase precursor (EC 3.2.1.1) (1,4-al... | 30 | 1.6 | 2 | FACE2_HUMAN (Q9Y256) CAAX prenyl protease 2 (EC 3.4.22.-) (Preny... | 29 | 3.6 | 3 | FACE2_MOUSE (P57791) CAAX prenyl protease 2 (EC 3.4.22.-) (Preny... | 28 | 8.1 |
---|
>AMY1_ORYSA (P17654) Alpha-amylase precursor (EC 3.2.1.1) (1,4-alpha-D-glucan| glucanohydrolase) (Isozyme 1B) Length = 434 Score = 30.0 bits (66), Expect = 1.6 Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Frame = -1 Query: 250 GAPESNQAWNKHKICCVAECYDPYGSGRASASPPKDTAH----PHMNNKCTNEL 101 G P+S W H IC DPYG G + D A H+N + EL Sbjct: 141 GTPDSRLDWGPHMIC----RDDPYGDGTGNPDTGADFAAAPDIDHLNKRVQREL 190
>FACE2_HUMAN (Q9Y256) CAAX prenyl protease 2 (EC 3.4.22.-) (Prenyl| protein-specific endoprotease 2) (Farnesylated proteins-converting enzyme 2) (FACE-2) (hRCE1) Length = 329 Score = 28.9 bits (63), Expect = 3.6 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +1 Query: 82 GECTNVTIH--LYICCSYEGELYLWAVRLRLDH 174 G C V++ L + CSY G LY+W L DH Sbjct: 32 GLCCWVSVFSCLSLACSYVGSLYVWKSELPRDH 64
>FACE2_MOUSE (P57791) CAAX prenyl protease 2 (EC 3.4.22.-) (Prenyl| protein-specific endoprotease 2) (Farnesylated proteins-converting enzyme 2) (FACE-2) Length = 329 Score = 27.7 bits (60), Expect = 8.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 115 ICCSYEGELYLWAVRLRLDH 174 + CSY G LY+W L DH Sbjct: 45 LACSYVGSLYVWKSELPRDH 64 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,540,658 Number of Sequences: 219361 Number of extensions: 756995 Number of successful extensions: 1570 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1570 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)