| Clone Name | rbastl14b07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FOXJ3_MOUSE (Q8BUR3) Forkhead box protein J3 | 31 | 0.96 | 2 | UN13B_HUMAN (O14795) Unc-13 homolog B (Munc13-2) (munc13) | 30 | 1.6 | 3 | P2Y10_HUMAN (O00398) Putative P2Y purinoceptor 10 (P2Y10) (P2Y-l... | 29 | 3.7 | 4 | SIN1_SCHPO (Q9P7Y9) Stress-activated map kinase-interacting prot... | 28 | 8.2 |
|---|
>FOXJ3_MOUSE (Q8BUR3) Forkhead box protein J3| Length = 623 Score = 30.8 bits (68), Expect = 0.96 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 79 EQLSRLQQPHAADPPGSQHNKVHTAHRSHT 168 +Q S+LQ PH+ PP QH + H H+ T Sbjct: 406 QQHSQLQPPHSQHPPPHQHIQHHPNHQHQT 435
>UN13B_HUMAN (O14795) Unc-13 homolog B (Munc13-2) (munc13)| Length = 1591 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 73 GTEQLSRLQQPHAADPPGSQHNKVHTAHRSHT 168 G+ QLS L Q H D + + +H+ H SH+ Sbjct: 270 GSSQLSELDQYHEQDDDHRETDSIHSCHSSHS 301
>P2Y10_HUMAN (O00398) Putative P2Y purinoceptor 10 (P2Y10) (P2Y-like receptor)| Length = 339 Score = 28.9 bits (63), Expect = 3.7 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = -2 Query: 178 KTCWCDFCVRCELYYVVTLVGQLRVVAVIGLVALFLLFNYCEWKTYV 38 K+C+ D + V LVG + V + G V ++ +C WKT + Sbjct: 179 KSCFADLGYK--QMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTI 223
>SIN1_SCHPO (Q9P7Y9) Stress-activated map kinase-interacting protein 1| (SAPK-interacting protein 1) Length = 665 Score = 27.7 bits (60), Expect = 8.2 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 8/51 (15%) Frame = +1 Query: 88 SRLQQPHAADPPGSQH--------NKVHTAHRSHTNKSSQQFIGKLRDTLS 216 +++++ AA P S+H NK H H S T+ SQ+ ++DTL+ Sbjct: 386 AQIKENQAAYPFKSKHPTSIPEANNKTHIRHTSSTSSQSQKQAQDVKDTLN 436 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,828,052 Number of Sequences: 219361 Number of extensions: 552103 Number of successful extensions: 1566 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1565 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)