| Clone Name | rbastl14b06 |
|---|---|
| Clone Library Name | barley_pub |
>KGX15_CENLL (Q86QV0) Potassium channel toxin gamma-KTx 1.5 (Ergtoxin-like| protein 1) (ErgTx1) (CllErg1) (CllErgTx1) Length = 42 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -2 Query: 113 SCYQTSRFTRHAQHHLLHDAFTTKIGHRGIECMFYVC 3 SC SR +++ + D K GH G CMF+ C Sbjct: 4 SCVDKSRCSKYGYYQECQDC-CKKAGHNGGTCMFFKC 39
>KGX14_CENSC (Q86QU6) Potassium channel toxin gamma-KTx 1.4 (Ergtoxin-like| protein 1) (ErgTx1) (CsErg1) (CsErgTx1) Length = 42 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -2 Query: 113 SCYQTSRFTRHAQHHLLHDAFTTKIGHRGIECMFYVC 3 SC SR ++ + D K GH G CMF+ C Sbjct: 4 SCVDKSRCAKYGYYQECQDC-CKKAGHNGGTCMFFKC 39
>IF4E2_ARATH (O04663) Eukaryotic translation initiation factor 4E-2 (eIF4E-2)| (eIF-4E-2) (mRNA cap-binding protein) (eIF-(iso)4F 25 kDa subunit) (eIF-(iso)4F p28 subunit) (eIF4Eiso protein) (eIF(iso)4E) Length = 198 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -2 Query: 134 DHWGLIWSCYQTSRFTRHAQHHL 66 D WGL + +QTS+ T +A+ HL Sbjct: 61 DFWGLHETIFQTSKLTANAEIHL 83
>KGX16_CENEX (Q86QU1) Potassium channel toxin gamma-KTx 1.6 (Ergtoxin-like| protein 1) (ErgTx1) (CexErg1) (CexErgTx1) Length = 42 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -2 Query: 113 SCYQTSRFTRHAQHHLLHDAFTTKIGHRGIECMFYVC 3 SC SR ++ + D K GH G CMF+ C Sbjct: 4 SCVDKSRCAKYGYYQECQDC-CKKAGHSGGTCMFFKC 39
>KGX13_CENGR (Q86QV3) Potassium channel toxin gamma-KTx 1.3 (Ergtoxin-like| protein 1) (ErgTx1) (CgErg1) (CgErgTx1) Length = 42 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -2 Query: 113 SCYQTSRFTRHAQHHLLHDAFTTKIGHRGIECMFYVC 3 SC SR ++ + D K GH G CMF+ C Sbjct: 4 SCVDKSRCAKYGHYQECTDC-CKKYGHNGGTCMFFKC 39
>TX13B_HUMAN (Q9BXU2) Testis-expressed sequence 13B protein| Length = 312 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = +1 Query: 142 HRDGRKENQSVMWLKPPLSLQSLMQLMTCQSIRHDQPQDHVNTDEALLQ 288 HR G+ +N+ V WL+ L L+ ++ + Q + +EA Q Sbjct: 80 HRQGQLQNRRVQWLQGFAKLHRSAALVLASNLTELKEQQEMECNEATFQ 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,010,147 Number of Sequences: 219361 Number of extensions: 870627 Number of successful extensions: 1657 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1657 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)