Clone Name | rbastl14b04 |
---|---|
Clone Library Name | barley_pub |
>CWF19_SCHPO (Q09909) Cell cycle control protein cwf19| Length = 639 Score = 31.6 bits (70), Expect = 0.52 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +3 Query: 219 NQTGCETFHPGTENYHHSRHGNPGHPCHFGTHRPA 323 N+T ET H +HHSRH H H + RP+ Sbjct: 16 NETDRETNHSRRHRHHHSRHRESKHGRHDRSERPS 50
>SEPP1_RAT (P25236) Selenoprotein P precursor (SeP) [Contains: Selenoprotein| Se-P10; Selenoprotein Se-P6; Selenoprotein Se-P2; Selenoprotein Se-P1] Length = 385 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 225 TGCETFHPGTENYHHSRHGNPGHPCHFGTHRPAQS 329 T +T P E+ HH H GH H G+ +P+++ Sbjct: 193 TASKTTEPSEEHNHHKHHDKHGHE-HLGSSKPSEN 226
>TSA4_GIALA (P21849) Major surface-labeled trophozoite antigen 417 precursor| Length = 713 Score = 28.5 bits (62), Expect = 4.4 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -3 Query: 156 KSDRSAINSEQGCLEALFPPRSELVIVCYIFVASVICHKS 37 +SD + + +GCL PP ++ ++CY+ S +KS Sbjct: 639 ESDSNGVTGIKGCLNCAPPPNNKGSVLCYLIKDSGSTNKS 678
>PAND_BACHK (Q6HL14) Aspartate 1-decarboxylase precursor (EC 4.1.1.11)| (Aspartate alpha-decarboxylase) [Contains: Aspartate 1-decarboxylase beta chain; Aspartate 1-decarboxylase alpha chain] Length = 127 Score = 28.5 bits (62), Expect = 4.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 123 GCLEALFPPRSELVIVCYIFVASVICHKSYPKV 25 G L P +++I+CY VA HK PK+ Sbjct: 73 GAAARLVQPGDKVIIICYGLVAEENIHKQEPKI 105
>PAND_BACCZ (Q63DJ1) Aspartate 1-decarboxylase precursor (EC 4.1.1.11)| (Aspartate alpha-decarboxylase) [Contains: Aspartate 1-decarboxylase beta chain; Aspartate 1-decarboxylase alpha chain] Length = 127 Score = 28.5 bits (62), Expect = 4.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 123 GCLEALFPPRSELVIVCYIFVASVICHKSYPKV 25 G L P +++I+CY VA HK PK+ Sbjct: 73 GAAARLVQPGDKVIIICYGLVAEENIHKQEPKI 105
>PAND_BACC1 (Q73AV2) Aspartate 1-decarboxylase precursor (EC 4.1.1.11)| (Aspartate alpha-decarboxylase) [Contains: Aspartate 1-decarboxylase beta chain; Aspartate 1-decarboxylase alpha chain] Length = 127 Score = 28.5 bits (62), Expect = 4.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 123 GCLEALFPPRSELVIVCYIFVASVICHKSYPKV 25 G L P +++I+CY VA HK PK+ Sbjct: 73 GAAARLVQPGDKVIIICYGLVAEENIHKQEPKI 105
>PAND_BACAN (Q81ST1) Aspartate 1-decarboxylase precursor (EC 4.1.1.11)| (Aspartate alpha-decarboxylase) [Contains: Aspartate 1-decarboxylase beta chain; Aspartate 1-decarboxylase alpha chain] Length = 127 Score = 28.5 bits (62), Expect = 4.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 123 GCLEALFPPRSELVIVCYIFVASVICHKSYPKV 25 G L P +++I+CY VA HK PK+ Sbjct: 73 GAAARLVQPGDKVIIICYGLVAEENIHKQEPKI 105
>VGF_HUMAN (O15240) Neurosecretory protein VGF precursor| Length = 616 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 194 PLPSPLDEEPDWLRDLPSWN 253 P PS DE PDW LP W+ Sbjct: 512 PPPSARDELPDWNEVLPPWD 531 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,307,218 Number of Sequences: 219361 Number of extensions: 819774 Number of successful extensions: 2114 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2041 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2108 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)