Clone Name | rbastl14b03 |
---|---|
Clone Library Name | barley_pub |
>YDN1_SCHPO (P87293) Hypothetical protein C16A10.01 in chromosome I| Length = 830 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 168 NINTYNMMKSGEDRKPPGLLSNTTIMGHVPTRDMKIVQ 281 N TYN++ D P +S T M H P+ K++Q Sbjct: 232 NQYTYNLLGKSTDESPKITISAGTSMSHFPSASSKLIQ 269
>YJLA_BACSU (O34428) Hypothetical protein yjlA| Length = 324 Score = 29.3 bits (64), Expect = 2.5 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = -2 Query: 187 MLYVLMFAFFFLLPPTVQKSSRACIWSSVLAYVHKITFHC*AVDIR 50 +L L FA F+L ++ S + +WSS L ++ + F C V +R Sbjct: 8 ILASLFFAVTFILNRAMELSGGSWLWSSSLRFIFMVPFLCLIVIMR 53
>NNP1_HUMAN (P56182) NNP-1 protein (Novel nuclear protein 1) (Nucleolar protein| Nop52) (D21S2056E) Length = 461 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +2 Query: 110 PDTSSRRLLNRRRQKEKKSKH*YVQHDEERGR 205 P+ + RRLL RRQK+ K + ++ +ERG+ Sbjct: 345 PEKACRRLLEGRRQKKTKKQKRLLRLQQERGK 376
>MUS81_NEUCR (Q7SD49) Crossover junction endonuclease mus-81 (EC 3.1.22.-)| Length = 645 Score = 27.7 bits (60), Expect = 7.3 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +1 Query: 49 LLCPRLSSGK*SCEHMLKHLTRYKL*KTFEP--SEAKGKKKQTLI 177 L+C R SG+ + E T Y+L K FE S+ GKKKQ ++ Sbjct: 572 LMCIRRLSGEKAIEIQKVWKTPYQLVKAFEACGSDENGKKKQKVL 616
>SYL_COREF (Q8FLM0) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 957 Score = 27.7 bits (60), Expect = 7.3 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +2 Query: 263 GHEDCAALSSLEPFPFALTIWLFLELYRSY 352 GH+ A++S +P + T W+FL+++ S+ Sbjct: 147 GHDPRRAVASTDPEFYKWTQWIFLQIFNSW 176
>NAS37_CAEEL (Q93243) Zinc metalloproteinase nas-37 precursor (EC 3.4.24.21)| (Nematode astacin 37) Length = 765 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 263 PCWNVTHNCRVGQEAWRLTVFPALHHVVRINVCFFF 156 P +++ G+E WR + A+ HV + NVCF F Sbjct: 125 PNLTISYEFYGGEETWRQLIRSAIRHVEQ-NVCFKF 159
>RTN2_HUMAN (O75298) Reticulon-2 (Neuroendocrine-specific protein-like 1)| (NSP-like protein 1) (NSPLI) Length = 545 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 312 AKGNGSREDSAAQSSCPVLERDP 244 A+G GS EDS+ SS P+ + +P Sbjct: 151 ARGTGSGEDSSTSSSTPLEDEEP 173
>COAT_SOUV3 (Q04542) Capsid protein (Coat protein)| Length = 546 Score = 27.3 bits (59), Expect = 9.5 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = -2 Query: 169 FAFFFLLPPTVQKSSRA 119 F+F FL+PPT+++ +RA Sbjct: 215 FSFLFLVPPTIEQKTRA 231
>YAP2_YEAST (P24813) AP-1-like transcription activator YAP2 (Transcription| factor CAD1) (Cadmium resistance protein 1) Length = 409 Score = 27.3 bits (59), Expect = 9.5 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 10 HEKTIKSYKWRHELLCPRLSSGK*SCEHMLKHLT 111 H KTI++ E + +S+GK SC H+L+ ++ Sbjct: 331 HTKTIRTQSEAIEHISSAISNGKASCYHILEEIS 364
>SYL_STRAW (Q82C66) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 962 Score = 27.3 bits (59), Expect = 9.5 Identities = 9/34 (26%), Positives = 21/34 (61%) Frame = +2 Query: 251 RSNTGHEDCAALSSLEPFPFALTIWLFLELYRSY 352 R GH+ + ++++P + T W+FL+++ S+ Sbjct: 141 RLGLGHDKRRSFATIDPDYYKWTQWIFLQIFNSW 174 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,798,572 Number of Sequences: 219361 Number of extensions: 905906 Number of successful extensions: 2152 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2090 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2152 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)