| Clone Name | rbastl14a10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MQO_BLOFL (Q7VRS0) Probable malate:quinone oxidoreductase (EC 1.... | 29 | 6.9 | 2 | UCP1_MOUSE (P12242) Mitochondrial brown fat uncoupling protein 1... | 28 | 9.1 | 3 | IF2_LACSS (Q38W81) Translation initiation factor IF-2 | 28 | 9.1 |
|---|
>MQO_BLOFL (Q7VRS0) Probable malate:quinone oxidoreductase (EC 1.1.99.16)| (Malate dehydrogenase [acceptor]) (MQO) Length = 524 Score = 28.9 bits (63), Expect = 6.9 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -2 Query: 293 VSV*MDKLLLLSSPCWILHLFKESEKPQREIRSYYQCAPT 174 +SV + L + P WI+H+++ KP +E + + A T Sbjct: 31 MSVTLGSFLTILEPSWIIHIYERLNKPAQESSNSWNNAGT 70
>UCP1_MOUSE (P12242) Mitochondrial brown fat uncoupling protein 1 (UCP 1)| (Thermogenin) Length = 306 Score = 28.5 bits (62), Expect = 9.1 Identities = 34/144 (23%), Positives = 61/144 (42%), Gaps = 13/144 (9%) Frame = -3 Query: 424 RESATVEGASSVYVAGLP*LIRGTI--CAGYAAEEMGWRPEF**SRCLSEWISCSCC-LL 254 R AT E S+++ P L+R I C ++ + ++ L++ + C L Sbjct: 161 RVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDL-MKGALVNNKILADDVPCHLLSAL 219 Query: 253 PVGFC----------IFSKNLRSRKGRYVHIINVLQQ**LKEAGLDQFIASY*VIFIRVP 104 GFC + ++ + S G+Y + + KE G F + F+R+ Sbjct: 220 VAGFCTTLLASPVDVVKTRFINSLPGQYPSVPSCAMSMYTKE-GPTAFFKGFVASFLRLG 278 Query: 103 SCSHP*FVCVKQLSSVIMKCYETL 32 S + FVC +QL +MK +T+ Sbjct: 279 SWNVIMFVCFEQLKKELMKSRQTV 302
>IF2_LACSS (Q38W81) Translation initiation factor IF-2| Length = 937 Score = 28.5 bits (62), Expect = 9.1 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 248 NREKTARAAYPFRQTPASSKFRPP 319 N+EKT RAA+ + TPA+SK P Sbjct: 41 NQEKTLRAAFQTKATPAASKPATP 64 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,473,592 Number of Sequences: 219361 Number of extensions: 1159135 Number of successful extensions: 2344 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2341 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)