Clone Name | rbastl14a06 |
---|---|
Clone Library Name | barley_pub |
>DEF2_COXBU (Q83AK6) Peptide deformylase 2 (EC 3.5.1.88) (PDF 2) (Polypeptide| deformylase 2) Length = 209 Score = 32.7 bits (73), Expect = 0.39 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -1 Query: 212 IEGCSSIYARFGIGSKEIHLLLSVWVYM*PISAREN*MLQYHKK 81 IEGC S+ + G+ + +H+ L+ W+Y A +YH++ Sbjct: 98 IEGCLSVPGKVGVVERYVHVELTAWLYHSDTEALSKIKREYHRE 141
>SYGA_RICPR (Q9ZCB0) Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)| (Glycine--tRNA ligase alpha chain) (GlyRS) Length = 289 Score = 30.0 bits (66), Expect = 2.5 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = +3 Query: 51 AMMITCAIDT--FFMILQHSILPG*NRLHIHPNRQQQVDLLATNTKPSIDR*ASLY 212 A ++ C D F +Q S PG +R +HPNR Q KPS D LY Sbjct: 40 ATVLRCLGDKPWFIAYVQPSRRPGDSRYGMHPNRMQHYYQFQVILKPSPDNIQDLY 95
>S4A7_MOUSE (Q8BTY2) Sodium bicarbonate cotransporter 3 (Solute carrier family| 4 member 7) Length = 1034 Score = 28.9 bits (63), Expect = 5.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 278 HIPHISLTELDERCWRHEISLRW 346 HIPH TE+DE C+R W Sbjct: 112 HIPHDLFTEMDELCYRDGEEYEW 134
>S4A7_HUMAN (Q9Y6M7) Sodium bicarbonate cotransporter 3 (Sodium bicarbonate| cotransporter 2) (Sodium bicarbonate cotransporter 2b) (Bicarbonate transporter) (Solute carrier family 4 member 7) Length = 1214 Score = 28.9 bits (63), Expect = 5.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 278 HIPHISLTELDERCWRHEISLRW 346 HIPH TE+DE C+R W Sbjct: 107 HIPHDLFTEMDELCYRDGEEYEW 129
>S4A7_RAT (Q9R1N3) Sodium bicarbonate cotransporter 3 (Electroneutral sodium| bicarbonate cotransporter 1) (NBC-like protein) (Solute carrier family 4 member 7) Length = 1218 Score = 28.9 bits (63), Expect = 5.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 278 HIPHISLTELDERCWRHEISLRW 346 HIPH TE+DE C+R W Sbjct: 112 HIPHDLFTEMDELCYRDGEEYEW 134
>YDCO_ECOLI (P76103) Inner membrane protein ydcO| Length = 391 Score = 28.5 bits (62), Expect = 7.4 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -1 Query: 332 SHDASIARPIQLS*YAECVYGYLLSTKAAGRSAPVFVLVFIEG-CSSIYARFGIGS 168 +H S+A P+ L A + + KAAG SAPV L+ G + +++ FG+ S Sbjct: 209 AHSLSVALPLFLVTMASQNAPGIAAMKAAGYSAPVSPLIVFTGLLALVFSPFGVYS 264
>GNPTA_MOUSE (Q69ZN6) N-acetylglucosamine-1-phosphotransferase subunits alpha/beta| precursor (EC 2.7.8.17) (GlcNAc-1-phosphotransferase alpha/beta subunits) (UDP-N-acetylglucosamine-1-phosphotransferase alpha/beta subunits) (Stealth protein GNPTAB) [Conta Length = 1235 Score = 28.1 bits (61), Expect = 9.7 Identities = 19/60 (31%), Positives = 26/60 (43%) Frame = +3 Query: 54 MMITCAIDTFFMILQHSILPG*NRLHIHPNRQQQVDLLATNTKPSIDR*ASLYKYKHKDR 233 M+I C+ I Q + +P + PN L TN KP D+ YK K+K R Sbjct: 1032 MLINCSKMLPANITQLNNIPPTQEAYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDKNKYR 1091
>SYGA_RICCN (Q92G10) Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)| (Glycine--tRNA ligase alpha chain) (GlyRS) Length = 288 Score = 28.1 bits (61), Expect = 9.7 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 93 LQHSILPG*NRLHIHPNRQQQVDLLATNTKPSIDR*ASLY 212 +Q S PG +R +HPNR Q KPS D LY Sbjct: 56 VQPSRRPGDSRYGMHPNRMQHYYQFQVILKPSPDNIQELY 95 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,119,367 Number of Sequences: 219361 Number of extensions: 1225173 Number of successful extensions: 2631 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2631 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)