Clone Name | rbastl14a03 |
---|---|
Clone Library Name | barley_pub |
>YCF80_GUITH (O78449) Hypothetical 33.2 kDa protein ycf80| Length = 282 Score = 30.0 bits (66), Expect = 1.4 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +3 Query: 51 EILQTFPTKKNSRISIRSFLKYNSGCFKLIGDYMYSFIITG-SWELDSN 194 EI NSR+S KY+ FK I ++YS +T W L SN Sbjct: 216 EIKNILNVNSNSRVSFHPKQKYDKNWFKGIPIFIYSPTVTNLDWTLKSN 264
>CRY2_VIBCH (Q9KS67) Cryptochrome-like protein cry2| Length = 504 Score = 29.6 bits (65), Expect = 1.8 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 5/51 (9%) Frame = -2 Query: 310 SIAGFQRMLWAYSNRASF-CNF*LRSVHRRCE----DVNLAWSSLLSSSHD 173 S+AGF+R L A S+R + C+F ++ CE VN A+ SLL S D Sbjct: 253 SVAGFRRSLIALSSRLHWHCHF-IQKFESECEMEFRCVNRAYDSLLQQSSD 302
>FLHC_YEREN (O86047) Flagellar transcriptional activator flhC| Length = 193 Score = 29.3 bits (64), Expect = 2.4 Identities = 18/49 (36%), Positives = 21/49 (42%) Frame = -3 Query: 375 PPTKSFKRQMTLHEFVQRQCTDLLLVSRECCGPTLIVHRFATFNSGLCT 229 PP + R TL FV L L CCG T I H NS +C+ Sbjct: 113 PPLLALTRAWTLVRFVDSGM--LQLSGCNCCGGTFITHAHQPRNSFVCS 159
>SPA12_RAT (Q8R4Z1) Serpin A12 precursor (Visceral adipose-specific serpin)| (Visceral adipose tissue-derived serine protease inhibitor) (Vaspin) Length = 411 Score = 28.9 bits (63), Expect = 3.1 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = +1 Query: 142 EITCTVL*LQGRGNLTATMTMPN 210 +++CT+L + RGN+TAT +P+ Sbjct: 254 QLSCTILEMPYRGNITATFVLPD 276
>SPA12_MOUSE (Q7TMF5) Serpin A12 precursor (Visceral adipose-specific serpin)| (Visceral adipose tissue-derived serine protease inhibitor) (Vaspin) Length = 413 Score = 28.9 bits (63), Expect = 3.1 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = +1 Query: 142 EITCTVL*LQGRGNLTATMTMPN 210 +++CT+L + RGN+TAT +P+ Sbjct: 254 QLSCTILEIPYRGNITATFVLPD 276
>Y085_BUCBP (Q89AY5) Hypothetical UPF0011 protein bbp_085| Length = 292 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/58 (25%), Positives = 32/58 (55%) Frame = +3 Query: 27 KSLALVTTEILQTFPTKKNSRISIRSFLKYNSGCFKLIGDYMYSFIITGSWELDSNDD 200 K+ L++ +L+T K + +S +K +G +KL +Y+Y++ I + + N+D Sbjct: 236 KNTNLISDAVLKTLKILK-THLSFNKAIKITAGIYKLPKNYLYNYAINNT--ISKNND 290
>YFK5_SCHPO (P87132) Hypothetical protein C167.05 in chromosome I| Length = 601 Score = 27.7 bits (60), Expect = 6.9 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +2 Query: 242 ELKVAKRCTIRVGPQHSLETSNRSVHCL 325 ++K AK + +GP + T+NR++ C+ Sbjct: 388 DVKTAKSMKVDIGPTRWIPTANRTIRCI 415
>PBPA_VIBCH (Q9KNU5) Penicillin-binding protein 1A (PBP-1a) (PBP1a) [Includes:| Penicillin-insensitive transglycosylase (EC 2.4.2.-) (Peptidoglycan TGase); Penicillin-sensitive transpeptidase (EC 3.4.-.-) (DD-transpeptidase)] Length = 825 Score = 27.3 bits (59), Expect = 9.1 Identities = 19/77 (24%), Positives = 35/77 (45%) Frame = +3 Query: 111 KYNSGCFKLIGDYMYSFIITGSWELDSNDDHAKFTSSHRLCTDLS*KLQNDARLE*AHSI 290 KY+ +L Y+ I +W ++ + A +TS + T + KLQ A Sbjct: 251 KYHGAEIELNAPYVAE--IARAWMVERYGEEAAYTSGMNVYTTVDSKLQRAAN------- 301 Query: 291 LWKPAIDQYIAFEQTHG 341 + AI+ +A+++ HG Sbjct: 302 --QAAINNLLAYDERHG 316
>SWI6_KLULA (P40418) Regulatory protein SWI6 (Cell-cycle box factor, chain| SWI6) (Trans-acting activator of HO endonuclease gene) (MBF subunit P90) Length = 769 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +3 Query: 93 SIRSFLKYNSGCFKLIGDYMYSFII 167 S++S Y+SG F+++ DY+Y I+ Sbjct: 327 SVKSVNNYDSGTFEILLDYLYPCIV 351 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,859,678 Number of Sequences: 219361 Number of extensions: 1007885 Number of successful extensions: 2014 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1989 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2014 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)