Clone Name | rbastl13h07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IF4E2_ARATH (O04663) Eukaryotic translation initiation factor 4E... | 27 | 9.7 | 2 | TX13B_HUMAN (Q9BXU2) Testis-expressed sequence 13B protein | 27 | 9.7 |
---|
>IF4E2_ARATH (O04663) Eukaryotic translation initiation factor 4E-2 (eIF4E-2)| (eIF-4E-2) (mRNA cap-binding protein) (eIF-(iso)4F 25 kDa subunit) (eIF-(iso)4F p28 subunit) (eIF4Eiso protein) (eIF(iso)4E) Length = 198 Score = 27.3 bits (59), Expect = 9.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -2 Query: 117 DHWGLIWSCYQTSRFTRHAQHHL 49 D WGL + +QTS+ T +A+ HL Sbjct: 61 DFWGLHETIFQTSKLTANAEIHL 83
>TX13B_HUMAN (Q9BXU2) Testis-expressed sequence 13B protein| Length = 312 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = +2 Query: 125 HRDGRKENQSVMWLKPPLSLQSLMQLMTCQSIRHDQPQDHVNTDEALLQ 271 HR G+ +N+ V WL+ L L+ ++ + Q + +EA Q Sbjct: 80 HRQGQLQNRRVQWLQGFAKLHRSAALVLASNLTELKEQQEMECNEATFQ 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,819,908 Number of Sequences: 219361 Number of extensions: 802125 Number of successful extensions: 1458 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1458 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)