Clone Name | rbastl13g12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TRFR_RAT (Q01717) Thyrotropin-releasing hormone receptor (TRH-R)... | 28 | 7.8 |
---|
>TRFR_RAT (Q01717) Thyrotropin-releasing hormone receptor (TRH-R)| (Thyroliberin receptor) Length = 412 Score = 27.7 bits (60), Expect = 7.8 Identities = 16/57 (28%), Positives = 32/57 (56%) Frame = +2 Query: 122 FTSLHCSNRFWNILFHRTSIAGTIIVSCLFVYKEEESGFAPSFLLTTFMKHVMSMQL 292 FTS++C F+ + + ++ I++SC YK + ++P +L+ + +VM M L Sbjct: 152 FTSIYCMLWFFLLDLNISTYKDAIVISC--GYKISRNYYSPIYLMDFGVFYVMPMIL 206 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,010,022 Number of Sequences: 219361 Number of extensions: 636389 Number of successful extensions: 1186 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1181 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)