Clone Name | rbastl13f11 |
---|---|
Clone Library Name | barley_pub |
>TILS_BUCBP (Q89AX3) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 438 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +2 Query: 2 RLTVISQNNLRFSFRLLQC*HDIL*PTEYSKTTVHCYKLCKN 127 +L + +NNL F+FR + H + +E K + HC K+C N Sbjct: 30 QLLKLKKNNLNFTFRAIHINHQLHPDSE--KWSDHCKKICIN 69
>CCNB3_MOUSE (Q810T2) G2/mitotic-specific cyclin-B3| Length = 1396 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 126 FLHNL*QCTVVLEYSVGYNISCQHCRSRKLN 34 ++ NL C LEY GY ++ H RKLN Sbjct: 1319 YMRNLSNCVPTLEYFTGYKMAELHILVRKLN 1349
>NAD2_CAEEL (P32739) Sodium-dependent high-affinity dicarboxylate transporter 2| (Na(+)/dicarboxylate cotransporter 2) (NaDC-2) (ceNaDC2) Length = 551 Score = 27.7 bits (60), Expect = 7.6 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -3 Query: 176 VKWDVFVSPPMLLFLFSSYTI 114 ++W VF PPM ++L +SY I Sbjct: 241 LQWMVFAIPPMFVYLLASYII 261
>YKG6_CAEEL (P46556) Hypothetical protein B0285.6 in chromosome III| Length = 577 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 212 PGNEQGFFFSSSVKWDVFVSPPMLLFLFSSYTI 114 P + G + S W F PPM+ ++FSS+ I Sbjct: 246 PNEDHGISYLS---WMAFAIPPMIFYMFSSWFI 275
>RBL2_MAGMG (Q8RTI2) Ribulose bisphosphate carboxylase (EC 4.1.1.39) (RuBisCO)| Length = 459 Score = 27.7 bits (60), Expect = 7.6 Identities = 18/56 (32%), Positives = 24/56 (42%) Frame = -3 Query: 248 GLSATAA*LLLEPGNEQGFFFSSSVKWDVFVSPPMLLFLFSSYTICNNVLWFWSIL 81 G + A+ L L GN QG + K + F PP L LF N+ W +L Sbjct: 97 GKAMIASFLTLTVGNNQGMSDVENAKMEDFYVPPEFLKLFDGPAC--NISHMWKVL 150 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,673,757 Number of Sequences: 219361 Number of extensions: 853233 Number of successful extensions: 2398 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2398 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)