Clone Name | rbastl13f10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SECE_BUCAI (P57152) Preprotein translocase secE subunit | 30 | 1.8 | 2 | BACA_BACLI (O68006) Bacitracin synthetase 1 (BA1) [Includes: ATP... | 28 | 6.7 | 3 | SATT_HUMAN (P43007) Neutral amino acid transporter A (SATT) (Ala... | 28 | 6.7 | 4 | ASK10_YEAST (P48361) Protein ASK10 | 28 | 8.7 |
---|
>SECE_BUCAI (P57152) Preprotein translocase secE subunit| Length = 127 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 104 YHYRQNKQKVP*SPSWLSFSITPFFLI 184 +HY +NK K+P W+S SI FF++ Sbjct: 4 HHYNRNKHKIPEKVKWISISI--FFIL 28
>BACA_BACLI (O68006) Bacitracin synthetase 1 (BA1) [Includes: ATP-dependent| isoleucine adenylase (IleA) (Isoleucine activase); ATP-dependent cysteine adenylase (CysA) (Cysteine activase); ATP-dependent leucine adenylase (LeuA) (Leucine activase); ATP-depe Length = 5255 Score = 28.1 bits (61), Expect = 6.7 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +3 Query: 33 QLFPYRTGNSPSNSH*TEKTQNQTITTGKTNRKFHDHHL 149 +LFPY T + + Q + K NR FHDHH+ Sbjct: 2324 ELFPYITAGATVHV----LNQETRLDVEKLNRYFHDHHI 2358
>SATT_HUMAN (P43007) Neutral amino acid transporter A (SATT)| (Alanine/serine/cysteine/ threonine transporter) (ASCT1) Length = 532 Score = 28.1 bits (61), Expect = 6.7 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -3 Query: 170 ELWRRITKMVIMELSVCFACSDSLVLCFFCLMRIGG 63 E+ R+ +M+I+ L VC S + L CL R+GG Sbjct: 80 EMLLRMLRMIILPLVVCSLVSGAASLDASCLGRLGG 115
>ASK10_YEAST (P48361) Protein ASK10| Length = 1146 Score = 27.7 bits (60), Expect = 8.7 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +2 Query: 20 CITKSTISLQDGEFTLQFSLNRKNTEPNYHYRQN 121 C+T ST +LQDG T +L + +P Y + QN Sbjct: 759 CLTDSTFTLQDGT-TTSVNLKGRAEKPQYIHIQN 791 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,636,852 Number of Sequences: 219361 Number of extensions: 481193 Number of successful extensions: 1243 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1231 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1243 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)