Clone Name | rbastl13f09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NU4M_APILI (P34853) NADH-ubiquinone oxidoreductase chain 4 (EC 1... | 30 | 1.2 | 2 | LEPA2_RHOBA (Q7UE01) GTP-binding protein lepA2 | 30 | 1.6 | 3 | PLD_STRAT (Q53728) Phospholipase D precursor (EC 3.1.4.4) (Choli... | 28 | 4.6 |
---|
>NU4M_APILI (P34853) NADH-ubiquinone oxidoreductase chain 4 (EC 1.6.5.3) (NADH| dehydrogenase subunit 4) Length = 447 Score = 30.4 bits (67), Expect = 1.2 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 2/68 (2%) Frame = -2 Query: 251 VSKPWIFFLFLLKFT*NVSRVIGCFIPCNCVLNYGFDF*WPYPVLWAHDLADI--GIFLY 78 +S ++F LF+ K N++ +IG I N +LN F+ W + W + ++ ++ Y Sbjct: 15 MSMIYLFMLFMNKMKNNLNLIIGNLIIINLLLNL-FNLNW---IDWIYIFCNLSFNMYSY 70 Query: 77 GIYCIWLW 54 G+ + LW Sbjct: 71 GLIMLTLW 78
>LEPA2_RHOBA (Q7UE01) GTP-binding protein lepA2| Length = 598 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +3 Query: 51 WPQPNTVDSIQEDAYIC*IVCPQNWVRPSEIETVVQYTITRDETTNY 191 WP P+T+DS+ E I+ P+ +V P + + + + +T NY Sbjct: 390 WPDPSTIDSVSEPYIKAQILIPEEYVGP--VMELCREHRSESQTMNY 434
>PLD_STRAT (Q53728) Phospholipase D precursor (EC 3.1.4.4) (Choline| phosphatase) Length = 556 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 7/42 (16%) Frame = -2 Query: 113 AHDLADIGIFLYGI-------YCIWLWPYLCTDDDDPAKRWI 9 AH ++D+ + L G Y LW + C + DPAK W+ Sbjct: 242 AHPVSDVDMALSGPAAASAGKYLDTLWDWTCRNASDPAKVWL 283 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,219,604 Number of Sequences: 219361 Number of extensions: 814271 Number of successful extensions: 1816 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1773 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1816 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)