Clone Name | rbastl13f04 |
---|---|
Clone Library Name | barley_pub |
>VGLL4_MOUSE (Q80V24) Transcription cofactor vestigial-like protein 4 (Vgl-4)| Length = 287 Score = 31.6 bits (70), Expect = 0.47 Identities = 22/65 (33%), Positives = 28/65 (43%) Frame = +2 Query: 20 SNAPITGAANKAISLSYNHVYMPLPKYFSYVPALLYTNKATSILGGSITLRTMKSACLLR 199 S +PI AA A+SL H+Y LP AL K +S G S R ++ Sbjct: 107 SRSPIERAAAPAVSLHGGHLYASLPSLMEQPLAL---TKNSSDTGRSAVERQQNRPSVIT 163 Query: 200 CQGAG 214 C AG Sbjct: 164 CASAG 168
>R1AB_CVHSA (P59641) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [Includes:| Replicase polyprotein 1a (pp1a) (ORF1A)] [Contains: Leader protein; p65 homolog; NSP1 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); 3C-like proteinase (EC 3.4.22.-) (3CL-PRO) (3 Length = 7073 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 136 FVCVEQSWYIRKIFW*GHVYMVIAETDCFI--CCSCYWGI 23 FVCVE Y +F G+ I CF+ CC CY+G+ Sbjct: 3737 FVCVE---YYPLLFITGNTLQCIMLVYCFLGYCCCCYFGL 3773
>R1AB_BSCR3 (Q3I5J6) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [Includes:| Replicase polyprotein 1a (pp1a) (ORF1A)] [Contains: Leader protein; p65 homolog; NSP1 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); 3C-like proteinase (EC 3.4.22.-) (3CL-PRO) (3 Length = 7071 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 136 FVCVEQSWYIRKIFW*GHVYMVIAETDCFI--CCSCYWGI 23 FVCVE Y +F G+ I CF+ CC CY+G+ Sbjct: 3735 FVCVE---YYPLLFITGNTLQCIMLVYCFLGYCCCCYFGL 3771
>RP1_PAPHA (Q8MJ06) Oxygen-regulated protein 1 (Retinitis pigmentosa RP1| protein homolog) Length = 2152 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = +1 Query: 208 SRQDGKPQRIYPSANHRTDCQQVATSIDLGTQMTIY 315 +R G QR+YP N +++ ++++T + ++ IY Sbjct: 241 ARLPGISQRVYPKGNAKSESRKISTHMSSSSRSQIY 276
>SDR1_PICAB (Q08632) Short-chain type dehydrogenase/reductase (EC 1.-.-.-)| Length = 271 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/54 (24%), Positives = 26/54 (48%) Frame = +2 Query: 32 ITGAANKAISLSYNHVYMPLPKYFSYVPALLYTNKATSILGGSITLRTMKSACL 193 + G + I++S + V MP+P+Y +Y + T IL + + + C+ Sbjct: 154 VRGGGGRIINISSSLVAMPIPRYGAYTASKAAVEMMTRILAQELRGTQITANCV 207
>RP1_HUMAN (P56715) Oxygen-regulated protein 1 (Retinitis pigmentosa RP1| protein) (Retinitis pigmentosa 1 protein) Length = 2156 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = +1 Query: 208 SRQDGKPQRIYPSANHRTDCQQVATSIDLGTQMTIY 315 +R G QR+YP N +++ ++++T + ++ IY Sbjct: 241 ARLPGISQRVYPKGNAKSESRKISTHMSSSSRSQIY 276 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,522,905 Number of Sequences: 219361 Number of extensions: 1141091 Number of successful extensions: 2544 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2544 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)