ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl13d02 |
|---|---|
| Clone Library Name | barley_pub |
>FINC_BOVIN (P07589) Fibronectin (FN)| Length = 2265 Score = 30.8 bits (68), Expect = 1.3 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 Query: 3 NEGSTSEGIPQYSIMYKSRTNTTYN 77 NEGST+ QYS Y RTNT N Sbjct: 2221 NEGSTAHSYNQYSQRYHQRTNTNVN 2245
>GP113_HUMAN (Q8IZF5) Probable G-protein coupled receptor 113 precursor| (G-protein coupled receptor PGR23) Length = 1079 Score = 30.4 bits (67), Expect = 1.7 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 122 WANDGCTCHVLSVYVVISCICTRLVHYTVLWYP 24 W+ +GC V S C+C L ++VL P Sbjct: 729 WSKEGCQAQVASASPTAQCLCQHLTAFSVLMSP 761
>RELA_STAAW (P0A0E9) GTP pyrophosphokinase (EC 2.7.6.5) (ATP:GTP| 3'-pyrophosphotransferase) (ppGpp synthetase I) ((P)ppGpp synthetase) Length = 736 Score = 30.4 bits (67), Expect = 1.7 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = +2 Query: 89 KEHGMYIHRS--PNISEALERLASVQRLKSK 175 K HG+ +HR+ PNI ERL +V+ +KSK Sbjct: 623 KGHGIKVHRTDCPNIKNETERLINVEWVKSK 653
>RELA_STAAU (P0A0F0) GTP pyrophosphokinase (EC 2.7.6.5) (ATP:GTP| 3'-pyrophosphotransferase) (ppGpp synthetase I) ((P)ppGpp synthetase) Length = 736 Score = 30.4 bits (67), Expect = 1.7 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = +2 Query: 89 KEHGMYIHRS--PNISEALERLASVQRLKSK 175 K HG+ +HR+ PNI ERL +V+ +KSK Sbjct: 623 KGHGIKVHRTDCPNIKNETERLINVEWVKSK 653
>RELA_STAAS (Q6G8T5) GTP pyrophosphokinase (EC 2.7.6.5) (ATP:GTP| 3'-pyrophosphotransferase) (ppGpp synthetase I) ((P)ppGpp synthetase) Length = 736 Score = 30.4 bits (67), Expect = 1.7 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = +2 Query: 89 KEHGMYIHRS--PNISEALERLASVQRLKSK 175 K HG+ +HR+ PNI ERL +V+ +KSK Sbjct: 623 KGHGIKVHRTDCPNIKNETERLINVEWVKSK 653
>RELA_STAAR (Q6GG70) GTP pyrophosphokinase (EC 2.7.6.5) (ATP:GTP| 3'-pyrophosphotransferase) (ppGpp synthetase I) ((P)ppGpp synthetase) Length = 736 Score = 30.4 bits (67), Expect = 1.7 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = +2 Query: 89 KEHGMYIHRS--PNISEALERLASVQRLKSK 175 K HG+ +HR+ PNI ERL +V+ +KSK Sbjct: 623 KGHGIKVHRTDCPNIKNETERLINVEWVKSK 653
>RELA_STAAN (Q99TL8) GTP pyrophosphokinase (EC 2.7.6.5) (ATP:GTP| 3'-pyrophosphotransferase) (ppGpp synthetase I) ((P)ppGpp synthetase) Length = 736 Score = 30.4 bits (67), Expect = 1.7 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = +2 Query: 89 KEHGMYIHRS--PNISEALERLASVQRLKSK 175 K HG+ +HR+ PNI ERL +V+ +KSK Sbjct: 623 KGHGIKVHRTDCPNIKNETERLINVEWVKSK 653
>RELA_STAAM (Q931Q4) GTP pyrophosphokinase (EC 2.7.6.5) (ATP:GTP| 3'-pyrophosphotransferase) (ppGpp synthetase I) ((P)ppGpp synthetase) Length = 736 Score = 30.4 bits (67), Expect = 1.7 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = +2 Query: 89 KEHGMYIHRS--PNISEALERLASVQRLKSK 175 K HG+ +HR+ PNI ERL +V+ +KSK Sbjct: 623 KGHGIKVHRTDCPNIKNETERLINVEWVKSK 653
>RELA_STAES (Q8CS97) GTP pyrophosphokinase (EC 2.7.6.5) (ATP:GTP| 3'-pyrophosphotransferase) (ppGpp synthetase I) ((P)ppGpp synthetase) Length = 729 Score = 30.4 bits (67), Expect = 1.7 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = +2 Query: 89 KEHGMYIHRS--PNISEALERLASVQRLKSK 175 K HG+ +HR+ PNI +RL SV+ +KSK Sbjct: 616 KGHGIKVHRTDCPNIKNETDRLISVEWVKSK 646
>RELA_STAEQ (Q5HNR8) GTP pyrophosphokinase (EC 2.7.6.5) (ATP:GTP| 3'-pyrophosphotransferase) (ppGpp synthetase I) ((P)ppGpp synthetase) Length = 729 Score = 30.4 bits (67), Expect = 1.7 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = +2 Query: 89 KEHGMYIHRS--PNISEALERLASVQRLKSK 175 K HG+ +HR+ PNI +RL SV+ +KSK Sbjct: 616 KGHGIKVHRTDCPNIKNETDRLISVEWVKSK 646
>PDE4D_DROME (Q9W4T0) cAMP-specific 3',5'-cyclic phosphodiesterase, isoform M| (EC 3.1.4.17) (Learning/memory process protein) (Protein dunce) Length = 903 Score = 28.9 bits (63), Expect = 5.0 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 108 MYMPCSFCLCCY 73 +YM CSFC CCY Sbjct: 201 VYMVCSFCCCCY 212
>YL098_MIMIV (Q5UPH2) Putative BTB/POZ domain-containing protein L98| Length = 495 Score = 28.9 bits (63), Expect = 5.0 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 3/69 (4%) Frame = -2 Query: 213 KTYSVCFGEASKGFDLRRCTEASL---SRASEILGERWMYMPCSFCLCCYKLYLYETCTL 43 K Y VCF ++S ++ T L S+ S+I+ W+ CS CC T Sbjct: 343 KIYRVCFYDSS----IKIFTRKELVYESKYSKIIKIIWISTKCSLIFCCEN----GTIGT 394 Query: 42 YCIVVSPRK 16 YCI+ + K Sbjct: 395 YCIMTNETK 403
>YNFE_ECOLI (P77374) Putative dimethyl sulfoxide reductase chain ynfE precursor| (EC 1.8.99.-) (DMSO reductase) Length = 808 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/50 (28%), Positives = 29/50 (58%) Frame = +3 Query: 36 YSIMYKSRTNTTYNNINRKNMACTSIVRPIFLRPLRDLPQCSVSNQSLLK 185 + YKSRT++TY NI+ AC + +++ P+ D + ++N +++ Sbjct: 690 FGFHYKSRTHSTYGNIDLLKAACR---QEVWINPI-DAQKRGIANGDMVR 735
>XPO1_RAT (Q80U96) Exportin-1 (Exp1) (Chromosome region maintenance 1 protein| homolog) Length = 1071 Score = 28.1 bits (61), Expect = 8.6 Identities = 23/77 (29%), Positives = 31/77 (40%), Gaps = 4/77 (5%) Frame = +2 Query: 89 KEHGMYIHRSPNISEALERLASVQRLKSKPFEASPKHTLYVFLLVAE----RMTESCLAN 256 KEHG + + N+ EAL L+ LLV+E + + CL Sbjct: 331 KEHGQLLEKRLNLREAL------------------MEALHYMLLVSEVEETEIFKICLEY 372 Query: 257 LTHLHWLLYNSSSFSTT 307 HL LY S FST+ Sbjct: 373 WNHLAAELYRESPFSTS 389
>XPO1_MOUSE (Q6P5F9) Exportin-1 (Exp1) (Chromosome region maintenance 1 protein| homolog) Length = 1071 Score = 28.1 bits (61), Expect = 8.6 Identities = 23/77 (29%), Positives = 31/77 (40%), Gaps = 4/77 (5%) Frame = +2 Query: 89 KEHGMYIHRSPNISEALERLASVQRLKSKPFEASPKHTLYVFLLVAE----RMTESCLAN 256 KEHG + + N+ EAL L+ LLV+E + + CL Sbjct: 331 KEHGQLLEKRLNLREAL------------------MEALHYMLLVSEVEETEIFKICLEY 372 Query: 257 LTHLHWLLYNSSSFSTT 307 HL LY S FST+ Sbjct: 373 WNHLAAELYRESPFSTS 389 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,477,674 Number of Sequences: 219361 Number of extensions: 1084157 Number of successful extensions: 2951 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2899 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2949 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
