Clone Name | rbastl13b12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DUT_BIFLO (Q8G4E8) Deoxyuridine 5'-triphosphate nucleotidohydrol... | 31 | 0.75 | 2 | YCQ9_SCHPO (O13674) Hypothetical RNA-binding protein C74.09 in c... | 28 | 8.3 |
---|
>DUT_BIFLO (Q8G4E8) Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC| 3.6.1.23) (dUTPase) (dUTP pyrophosphatase) Length = 158 Score = 31.2 bits (69), Expect = 0.75 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 4/38 (10%) Frame = +2 Query: 5 FDENFNKLQSTNILLKSL----VAEVHFITYKDATSDL 106 FDE +N+ +ST +L+KSL A++H+ DA +DL Sbjct: 3 FDETYNEPESTEVLVKSLDPEHPAQLHYAHAGDAGADL 40
>YCQ9_SCHPO (O13674) Hypothetical RNA-binding protein C74.09 in chromosome III| Length = 654 Score = 27.7 bits (60), Expect = 8.3 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 17 FNKLQSTNILLKSLVAEVHFITYKDATSDLPVL*C 121 F K++ IL K +A VHF+ +DA + L C Sbjct: 322 FGKIEHIKILSKKNIAFVHFLNIRDAIKVVRTLSC 356 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,200,046 Number of Sequences: 219361 Number of extensions: 497063 Number of successful extensions: 974 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 971 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 974 length of database: 80,573,946 effective HSP length: 53 effective length of database: 68,947,813 effective search space used: 1654747512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)