Clone Name | rbastl13b08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TILS_BUCBP (Q89AX3) tRNA(Ile)-lysidine synthase (EC 6.3.4.-) (tR... | 29 | 3.0 | 2 | CCNB3_MOUSE (Q810T2) G2/mitotic-specific cyclin-B3 | 29 | 3.0 |
---|
>TILS_BUCBP (Q89AX3) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 438 Score = 29.3 bits (64), Expect = 3.0 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +2 Query: 32 RLTVISQNNLRFNFRLLQC*HDIL*PTEYSKTTVHCYKLCKN 157 +L + +NNL F FR + H + +E K + HC K+C N Sbjct: 30 QLLKLKKNNLNFTFRAIHINHQLHPDSE--KWSDHCKKICIN 69
>CCNB3_MOUSE (Q810T2) G2/mitotic-specific cyclin-B3| Length = 1396 Score = 29.3 bits (64), Expect = 3.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 156 FLHNL*QCTVVLEYSVGYNISCQHCRSRKLN 64 ++ NL C LEY GY ++ H RKLN Sbjct: 1319 YMRNLSNCVPTLEYFTGYKMAELHILVRKLN 1349 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,878,204 Number of Sequences: 219361 Number of extensions: 401214 Number of successful extensions: 949 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 940 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 949 length of database: 80,573,946 effective HSP length: 41 effective length of database: 71,580,145 effective search space used: 1717923480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)