Clone Name | rbastl13b06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LOX21_HORVU (P93184) Lipoxygenase 2.1, chloroplast precursor (EC... | 29 | 3.9 | 2 | ISIA_SYNP7 (P15347) Iron stress-induced chlorophyll-binding prot... | 28 | 8.8 | 3 | ISIA_SYNP6 (Q5N675) Iron stress-induced chlorophyll-binding prot... | 28 | 8.8 | 4 | ACDE2_METTE (Q9C4Z3) Acetyl-CoA decarbonylase/synthase complex e... | 28 | 8.8 |
---|
>LOX21_HORVU (P93184) Lipoxygenase 2.1, chloroplast precursor (EC 1.13.11.12)| (LOX-100) (LOX2:Hv:1) Length = 936 Score = 28.9 bits (63), Expect = 3.9 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 181 MVMEMGIPNSISI 143 MVMEMGIPNSISI Sbjct: 924 MVMEMGIPNSISI 936
>ISIA_SYNP7 (P15347) Iron stress-induced chlorophyll-binding protein (CP43')| Length = 342 Score = 27.7 bits (60), Expect = 8.8 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = +3 Query: 3 GQHIYISSCPLIIIGGSFPLYPPPGQETEDTLIY---A*LSYT 122 G H+Y+ ++I GG + + PP Q T+ LIY A LSY+ Sbjct: 205 GGHVYVGV--MLIAGGIWHILVPPFQWTKKVLIYSGEAILSYS 245
>ISIA_SYNP6 (Q5N675) Iron stress-induced chlorophyll-binding protein (CP43')| Length = 342 Score = 27.7 bits (60), Expect = 8.8 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = +3 Query: 3 GQHIYISSCPLIIIGGSFPLYPPPGQETEDTLIY---A*LSYT 122 G H+Y+ ++I GG + + PP Q T+ LIY A LSY+ Sbjct: 205 GGHVYVGV--MLIAGGIWHILVPPFQWTKKVLIYSGEAILSYS 245
>ACDE2_METTE (Q9C4Z3) Acetyl-CoA decarbonylase/synthase complex epsilon subunit| 2 (ACDS complex epsilon subunit 2) Length = 170 Score = 27.7 bits (60), Expect = 8.8 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 79 WPGGGYNGNEPPIIIKGHDDIYI 11 WPG NGN II+ GH YI Sbjct: 99 WPGLDGNGNYDTIILLGHKKYYI 121 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,364,267 Number of Sequences: 219361 Number of extensions: 577009 Number of successful extensions: 1345 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1342 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)