Clone Name | rbastl13b03 |
---|---|
Clone Library Name | barley_pub |
>PA2G6_RAT (P97570) 85 kDa calcium-independent phospholipase A2 (EC 3.1.1.4)| (iPLA2) (CaI-PLA2) (Group VI phospholipase A2) (GVI PLA2) Length = 751 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 215 NHMVW*STFLFIEKGFRPCFNH 150 NH W T L +E G R CF+H Sbjct: 115 NHPSWTVTHLAVELGIRECFHH 136
>PA2G6_MOUSE (P97819) 85 kDa calcium-independent phospholipase A2 (EC 3.1.1.4)| (iPLA2) (CaI-PLA2) (Group VI phospholipase A2) (GVI PLA2) Length = 752 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 215 NHMVW*STFLFIEKGFRPCFNH 150 NH W T L +E G R CF+H Sbjct: 116 NHPSWTVTHLAVELGIRECFHH 137
>ATR_ASHGO (Q75DB8) Serine/threonine-protein kinase MEC1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase MEC1) (Mitosis entry checkpoint protein 1) (ATR homolog) Length = 2324 Score = 27.7 bits (60), Expect = 7.1 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = -3 Query: 300 WLKAKANLSSVQLSNCYFSIIHIGRLANKPY---GLVIYLLVYRKR 172 WL N +SVQ+S+ Y +I + + ++PY GL L+ +KR Sbjct: 1727 WLDLSNNATSVQISHQYKEVIGLDKDWDEPYYSFGLYYSRLLEKKR 1772
>I28RA_MOUSE (Q8CGK5) Interleukin-28 receptor alpha chain precursor| (IL-28R-alpha) (IL-28RA) (Cytokine receptor family 2 member 12) (Cytokine receptor class-II member 12) (CRF2-12) (Interferon lambda receptor 1) (IFN-lambda R1) Length = 535 Score = 27.7 bits (60), Expect = 7.1 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = -1 Query: 371 EGTSAWRLPGCFLSPRQPSSRPAFG*RLKPTYPPFSCRTVTF 246 +G S WR+ G S R L P PP S +T+TF Sbjct: 444 DGLSGWRISGSLSSKRD----------LAPVEPPVSLQTLTF 475
>ARMET_DROME (Q9XZ63) ARMET-like protein precursor| Length = 173 Score = 27.7 bits (60), Expect = 7.1 Identities = 19/64 (29%), Positives = 30/64 (46%) Frame = +3 Query: 111 IDNNTTPRKTRYHMIKTGTKAFFDKQEGRSPNHMVYSLGGLYELSKSNSSTAERRISWL* 290 +D++T K Y I+T K F Q+ + + Y LGGL E + + + +SW Sbjct: 42 LDDST---KKDYKQIETAFKKFCKAQKNKE-HRFCYYLGGLEESATGILNELSKPLSWSM 97 Query: 291 PLAK 302 P K Sbjct: 98 PAEK 101
>APOM_RAT (P14630) Apolipoprotein M precursor (Apo-M) (ApoM) (Protein Px)| Length = 190 Score = 27.3 bits (59), Expect = 9.2 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -2 Query: 253 LLFDNSYRPPSE*TIWFGDLPSCLSKKAFV 164 LL++ S PP E F L SCL KAF+ Sbjct: 147 LLYNRSPHPPEECVEEFQSLTSCLDFKAFL 176 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,989,933 Number of Sequences: 219361 Number of extensions: 1013994 Number of successful extensions: 2053 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2053 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)