Clone Name | rbastl13b01 |
---|---|
Clone Library Name | barley_pub |
>HD_FUGRU (P51112) Huntingtin (Huntington disease protein homolog) (HD protein)| Length = 3148 Score = 31.2 bits (69), Expect = 0.66 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 138 HNVLEMLLLTAVSCHTVNIRAWQQKSRGLAE 230 H VLEM +L CH N W++ SR +A+ Sbjct: 1577 HQVLEMFILVLQQCHKENEDKWKRLSRQIAD 1607
>SPOT_MYCPN (P75386) Probable guanosine-3',5'-bis(diphosphate)| 3'-pyrophosphohydrolase (EC 3.1.7.2) ((ppGpp)ase) (Penta-phosphate guanosine-3'-pyrophosphohydrolase) Length = 733 Score = 31.2 bits (69), Expect = 0.66 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 5/60 (8%) Frame = -2 Query: 223 RPRDFCCQALIFTVWQDTAVNKSI-----SNTLCKTVAPRCQKNCHLGHLEAKTFFQQMH 59 RPR F CQ I VW +T VNK + ++ + + P+ K L F H Sbjct: 653 RPRKFRCQINIRGVWSETTVNKIVQTIIEGDSYLERIIPKIDKQKDEFELNITMFIDNYH 712
>HD_HUMAN (P42858) Huntingtin (Huntington disease protein) (HD protein)| Length = 3144 Score = 31.2 bits (69), Expect = 0.66 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 138 HNVLEMLLLTAVSCHTVNIRAWQQKSRGLAE 230 H VLEM +L CH N W++ SR +A+ Sbjct: 1584 HQVLEMFILVLQQCHKENEDKWKRLSRQIAD 1614
>HD_RAT (P51111) Huntingtin (Huntington disease protein homolog) (HD protein)| Length = 3110 Score = 30.8 bits (68), Expect = 0.86 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 138 HNVLEMLLLTAVSCHTVNIRAWQQKSRGLAE 230 H VLEM +L CH N W++ SR +A+ Sbjct: 1553 HQVLEMFILVLQQCHKENEDKWKRLSRQVAD 1583
>HD_MOUSE (P42859) Huntingtin (Huntington disease protein homolog) (HD protein)| Length = 3119 Score = 30.8 bits (68), Expect = 0.86 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 138 HNVLEMLLLTAVSCHTVNIRAWQQKSRGLAE 230 H VLEM +L CH N W++ SR +A+ Sbjct: 1562 HQVLEMFILVLQQCHKENEDKWKRLSRQVAD 1592
>1A12_CUCMA (Q00257) 1-aminocyclopropane-1-carboxylate synthase CMA101 (EC| 4.4.1.14) (ACC synthase) (S-adenosyl-L-methionine methylthioadenosine-lyase) Length = 475 Score = 28.1 bits (61), Expect = 5.6 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 199 PGSKSHAAWPKNQSHASHEIIGRIHVIYSLQVDKGI 306 PG S K +S E+ R+H++YSL D G+ Sbjct: 241 PGFVSAMEVLKERSSEDEEVWKRVHIVYSLSKDLGL 276
>SYT_PROMM (Q7V8D2) Threonyl-tRNA synthetase (EC 6.1.1.3) (Threonine--tRNA| ligase) (ThrRS) Length = 640 Score = 28.1 bits (61), Expect = 5.6 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = +3 Query: 111 FWHRGATVLHNVLEMLLLTAVSCHTV-NIRAWQQKSRGLAEKSKSCKPRNHW 263 FWH ++ VLE + +S H IR Q R L EKS HW Sbjct: 264 FWHAKGWAIYQVLEQYIRETLSLHDYQEIRTPQVVDRSLWEKS------GHW 309
>UPP_PSEPK (Q88PV2) Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP| pyrophosphorylase) (UPRTase) Length = 212 Score = 28.1 bits (61), Expect = 5.6 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 23 PLNFSNGSSVTKMHLLKKSFCLQMPQMAVFLAPRG 127 P+ + GS V + LLKK+ C ++ M + AP G Sbjct: 131 PMLATGGSMVATIDLLKKAGCKEIRAMVLVAAPEG 165
>TOP3A_HUMAN (Q13472) DNA topoisomerase 3-alpha (EC 5.99.1.2) (DNA topoisomerase| III alpha) Length = 1001 Score = 27.7 bits (60), Expect = 7.3 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = +1 Query: 1 HLLEQCFASKFLKWQFCNK----DASVEKKFLPPN 93 HLL F +F KWQ CN +A +E K+ P N Sbjct: 92 HLLAHDFQMQFRKWQSCNPLVLFEAEIE-KYCPEN 125
>TOP3A_MOUSE (O70157) DNA topoisomerase 3-alpha (EC 5.99.1.2) (DNA topoisomerase| III alpha) Length = 1003 Score = 27.7 bits (60), Expect = 7.3 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = +1 Query: 1 HLLEQCFASKFLKWQFCNK----DASVEKKFLPPN 93 HLL F +F KWQ CN +A +E K+ P N Sbjct: 92 HLLAHDFQMQFRKWQSCNPLVLFEAEIE-KYCPEN 125
>RIF1_YEAST (P29539) Protein RIF1 (RAP1-interacting factor 1)| Length = 1916 Score = 27.3 bits (59), Expect = 9.5 Identities = 15/61 (24%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Frame = +3 Query: 174 SCHTVNIRAWQQKSRGLAEKSKSCKPRNHW*NS---CNIQSTGRQRYS*PLQAIQVPSSL 344 S + +N +++ Q + + K +P N N+ CN++ R P IQ+PS Sbjct: 1559 SMNKINSKSFTQDNIAQYKSVKKARPNNEGENNDYACNVEQASPVRNEVPGDGIQIPSGT 1618 Query: 345 L 347 + Sbjct: 1619 I 1619 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,196,352 Number of Sequences: 219361 Number of extensions: 1073159 Number of successful extensions: 2618 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2618 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)