Clone Name | rbastl13a12 |
---|---|
Clone Library Name | barley_pub |
>UPL1_ARATH (Q8GY23) E3 ubiquitin protein ligase UPL1 (EC 6.3.2.-)| (Ubiquitin-protein ligase 1) Length = 3684 Score = 28.9 bits (63), Expect = 3.7 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 72 ELDYQGTHCNTSVTSK*AGSPVIH 1 E+D+ NT TS AGSPVIH Sbjct: 3563 EIDFDDLKANTEYTSYTAGSPVIH 3586
>CYB_DICDI (Q37311) Cytochrome b| Length = 389 Score = 28.9 bits (63), Expect = 3.7 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 45 YSGYPDNLVLPPSNVLMTHLQPE 113 Y G+PDN ++ SNV H+ PE Sbjct: 250 YLGHPDNYLMADSNVTPAHIVPE 272
>IF2_PHOPR (Q6LUJ2) Translation initiation factor IF-2| Length = 899 Score = 28.5 bits (62), Expect = 4.8 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +3 Query: 60 DNLVLPPSNVLMTHLQPELGHIAWCTAHPRCDVPREKHLVFGLPGQANIRRIVTVQVRL* 239 DN+ L++HLQ E G + R + R+ H + G + V V+VR Sbjct: 35 DNVSQTEKQSLLSHLQKEHGGESTDGTPTRLTLQRKTHSTLSVAGTGGKSKSVQVEVRKK 94 Query: 240 RTY 248 RT+ Sbjct: 95 RTF 97
>ALYS_BPR1T (Q38135) N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)| Length = 270 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 191 WEAKHEVLFPGYVATGVGRAPRDMTQFRL*MSH 93 W+ + V PGYVA G G + + F++ +SH Sbjct: 63 WDKVYLVGEPGYVAYGAGSPANERSPFQIELSH 95
>TILS_ANAMM (Q5P9R1) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 466 Score = 27.7 bits (60), Expect = 8.2 Identities = 13/44 (29%), Positives = 18/44 (40%) Frame = +2 Query: 32 VTEVLQWVXXXXXXXXVQCTHDSSTTGIGSYRVVHGPPPLRRTQ 163 + E +QW + CTH++S S H P P TQ Sbjct: 352 IAETIQW--DRRFAIKIMCTHNASAAETTSCSAKHAPNPSEETQ 393
>Y177_TREPA (O83207) Hypothetical protein TP0177| Length = 436 Score = 27.7 bits (60), Expect = 8.2 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 12/40 (30%) Frame = -3 Query: 245 SPSQPYLYRNNTPDICLP-----WEAKH-------EVLFP 162 S Q LYRN +PDIC+ W A+H VLFP Sbjct: 154 SALQALLYRNISPDICMSTDGSFWAAEHFPPAPTLPVLFP 193
>YRAI_BACSU (O07909) Hypothetical protein yraI| Length = 144 Score = 27.7 bits (60), Expect = 8.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 188 PRASKYPAYCYGTGTVVT 241 P ++ P YCY TGT VT Sbjct: 82 PSGTRIPIYCYKTGTTVT 99
>SC24A_MOUSE (Q3U2P1) Protein transport protein Sec24A (SEC24-related protein A)| Length = 1090 Score = 27.7 bits (60), Expect = 8.2 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 137 GPPPLRRTQGKAPRVWPPRASKYPAY 214 GPPP R G AP+ PPRA+ P++ Sbjct: 215 GPPPSR---GPAPQKTPPRAAPPPSF 237 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,718,528 Number of Sequences: 219361 Number of extensions: 966322 Number of successful extensions: 2534 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2532 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)