Clone Name | rbastl13a10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DICER_MOUSE (Q8R418) Endoribonuclease Dicer (EC 3.1.26.-) (Doubl... | 29 | 3.7 | 2 | NU5M_TRIRE (Q8SHP7) NADH-ubiquinone oxidoreductase chain 5 (EC 1... | 28 | 4.9 |
---|
>DICER_MOUSE (Q8R418) Endoribonuclease Dicer (EC 3.1.26.-) (Double-strand-specific| ribonuclease mDCR-1) Length = 1906 Score = 28.9 bits (63), Expect = 3.7 Identities = 17/57 (29%), Positives = 24/57 (42%) Frame = +2 Query: 23 NECPSVLNKLKFVGPNASTSLGNRTIASTEEKMGRKKAYKENAGCFLLPGAGRLQKT 193 NECP + N N STS G+ +++ M KA K+ P G +T Sbjct: 1223 NECPLLSNTYLDGNANTSTSDGSPAVSTMPAMMNAVKALKDRMDSEQSPSVGYSSRT 1279
>NU5M_TRIRE (Q8SHP7) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3)| Length = 692 Score = 28.5 bits (62), Expect = 4.9 Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 3/34 (8%) Frame = -1 Query: 147 FSL*AFFLPIFSSVLAMV---RLPKLVLAFGPTN 55 F L FFL IF SVL++V +PK+V+ F TN Sbjct: 509 FKLLPFFLTIFFSVLSIVYYEYMPKVVVDFNLTN 542 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,123,550 Number of Sequences: 219361 Number of extensions: 579539 Number of successful extensions: 1581 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1580 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)