Clone Name | rbastl13a09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DHH1_CANGA (Q6FQU5) ATP-dependent RNA helicase DHH1 (EC 3.6.1.-) | 29 | 3.6 | 2 | SGS3_DROYA (P13728) Salivary glue protein Sgs-3 precursor | 28 | 4.6 | 3 | AEF1_DROME (P39413) Adult enhancer factor 1 (AEF-1) | 28 | 6.1 | 4 | META_VIBPA (Q87NW7) Homoserine O-succinyltransferase (EC 2.3.1.4... | 23 | 8.1 |
---|
>DHH1_CANGA (Q6FQU5) ATP-dependent RNA helicase DHH1 (EC 3.6.1.-)| Length = 507 Score = 28.9 bits (63), Expect = 3.6 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 110 RKQTHNATQTQPQPGHRVRRPGDTTFVLPQVSFSLFLPIP 229 ++Q Q Q Q G + PG F+ PQ F+P+P Sbjct: 429 QEQQQQQQQQQGQQGQQQGYPGQQAFIPPQQGQPQFMPVP 468
>SGS3_DROYA (P13728) Salivary glue protein Sgs-3 precursor| Length = 263 Score = 28.5 bits (62), Expect = 4.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +2 Query: 53 PTFRSTHPTHSTYSNTTEYRKQTHNATQTQP-QPGHRVRRPGDTT 184 PT RST H+T + TT R T T +P RRP TT Sbjct: 109 PTTRSTTTRHTTTTTTTTRRPTTTTTTTRRPTTTTTTTRRPTTTT 153 Score = 28.1 bits (61), Expect = 6.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 53 PTFRSTHPTHSTYSNTTEYRKQTHNATQTQPQP 151 PT RST H+T S T+ ++ TH T T +P Sbjct: 159 PTTRSTTTRHTTKSTTS--KRPTHETTTTSKRP 189
>AEF1_DROME (P39413) Adult enhancer factor 1 (AEF-1)| Length = 308 Score = 28.1 bits (61), Expect = 6.1 Identities = 18/73 (24%), Positives = 31/73 (42%), Gaps = 9/73 (12%) Frame = +2 Query: 5 CNIILIRRKK-----NSSNLEPTFRSTHPTH----STYSNTTEYRKQTHNATQTQPQPGH 157 C+I+++ + N++N E ++THP H + ++Q H+ Q Q G Sbjct: 21 CDIVIVAAQPQTTIANNNNNETVTQATHPAHMAAVQQQQQQQQQQQQQHHQQQQQQSSGP 80 Query: 158 RVRRPGDTTFVLP 196 P T LP Sbjct: 81 PSVPPPPTELPLP 93
>META_VIBPA (Q87NW7) Homoserine O-succinyltransferase (EC 2.3.1.46) (Homoserine| O-transsuccinylase) (HTS) Length = 313 Score = 23.1 bits (48), Expect(2) = 8.1 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +2 Query: 107 YRKQTHNATQTQPQPGHRVRRPGDTTFVLPQVSFSLFLP 223 Y Q HN P H + R D TF+ P ++ F P Sbjct: 168 YHHQIHN-------PFHPILRGFDDTFLAPHSRYADFSP 199 Score = 23.1 bits (48), Expect(2) = 8.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 22 KTQKKQLQSRTHFQIHTP 75 KT+K++L H QIH P Sbjct: 158 KTRKEKLSGVYHHQIHNP 175 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,580,470 Number of Sequences: 219361 Number of extensions: 588667 Number of successful extensions: 1750 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1749 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)