Clone Name | rbastl13a08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PPK_BACHD (Q9KD27) Polyphosphate kinase (EC 2.7.4.1) (Polyphosph... | 30 | 1.7 | 2 | SSB_WIGBR (Q8D254) Single-stranded DNA-binding protein (SSB) (He... | 29 | 3.8 | 3 | Y3311_PSEAE (Q9HYT3) Hypothetical signaling protein PA3311 | 28 | 8.5 |
---|
>PPK_BACHD (Q9KD27) Polyphosphate kinase (EC 2.7.4.1) (Polyphosphoric acid| kinase) (ATP-polyphosphate phosphotransferase) Length = 705 Score = 30.0 bits (66), Expect = 1.7 Identities = 16/70 (22%), Positives = 32/70 (45%) Frame = +1 Query: 7 WKHNDIPSIHPYKIRQFTPFPVHERSQRDPLQPTRSEIRMGRKRRRILLGFFTGTNATDS 186 +K + S+ P++I + P+HE RD L+ E++ + + L G + Sbjct: 227 FKGYTVKSVSPFRITRNADLPIHEEGARDLLREIEKELKKRKWGAAVRLEMQEGLMDPNV 286 Query: 187 LSFLVNLRHI 216 L L+++ I Sbjct: 287 LKLLLDVLEI 296
>SSB_WIGBR (Q8D254) Single-stranded DNA-binding protein (SSB)| (Helix-destabilizing protein) Length = 163 Score = 28.9 bits (63), Expect = 3.8 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +3 Query: 42 QDQAIHTISSP*TVTERSITTYQV-RDKNGEEEKENTTWLFHRDERHRFIVF 194 QD + I + +T S+ T + RDKN E KE T W HR I+F Sbjct: 17 QDPEVRYIPNGNAITNLSLATSENWRDKNTGESKEKTEW-------HRVILF 61
>Y3311_PSEAE (Q9HYT3) Hypothetical signaling protein PA3311| Length = 783 Score = 27.7 bits (60), Expect = 8.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 1 VFWKHNDIPSIHPYKIRQF 57 ++WKHN PS HP + R F Sbjct: 32 LYWKHNATPSPHPRRPRVF 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,418,264 Number of Sequences: 219361 Number of extensions: 457163 Number of successful extensions: 1241 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1241 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)