ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl13a07 |
|---|---|
| Clone Library Name | barley_pub |
>PAL2_ORYSA (P53443) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 710 Score = 32.7 bits (73), Expect = 0.24 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 LKEWNGEPLPIC Sbjct: 699 LKEWNGEPLPIC 710
>PALY_WHEAT (Q43210) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 700 Score = 32.0 bits (71), Expect = 0.41 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 LKEWNGEPLP+C Sbjct: 689 LKEWNGEPLPLC 700
>PALY_CITLI (Q42667) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 722 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 LKEWNG PLPIC Sbjct: 709 LKEWNGAPLPIC 720
>PAL3_TOBAC (P45733) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 712 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 LKEWNG PLPIC Sbjct: 701 LKEWNGAPLPIC 712
>PAL2_TOBAC (P35513) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 712 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 LKEWNG PLPIC Sbjct: 701 LKEWNGAPLPIC 712
>PAL2_CICAR (Q9SMK9) Phenylalanine ammonia-lyase 2 (EC 4.3.1.5)| Length = 718 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 LKEWNG PLPIC Sbjct: 707 LKEWNGAPLPIC 718
>PAL1_POPKI (P45731) Phenylalanine ammonia-lyase G1 (EC 4.3.1.5)| Length = 682 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 LKEWNG PLPIC Sbjct: 671 LKEWNGAPLPIC 682
>PALY_BROFI (Q42609) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 703 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 LKEWNG PLPIC Sbjct: 692 LKEWNGAPLPIC 703
>PALY_CAMSI (P45726) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 714 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 LKEWNG PLPIC Sbjct: 703 LKEWNGAPLPIC 714
>PAL4_POPKI (Q40910) Phenylalanine ammonia-lyase G4 (EC 4.3.1.5) (Fragment)| Length = 571 Score = 29.6 bits (65), Expect = 2.0 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 LKEWNG PLP+C Sbjct: 560 LKEWNGAPLPLC 571
>PAL2_ARATH (P45724) Phenylalanine ammonia-lyase 2 (EC 4.3.1.5)| Length = 717 Score = 29.6 bits (65), Expect = 2.0 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 LKEWNG P+PIC Sbjct: 706 LKEWNGAPIPIC 717
>PAL1_ORYSA (P14717) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 701 Score = 29.3 bits (64), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 293 LKEWNGEPLPI 261 LKEWNGEPLPI Sbjct: 690 LKEWNGEPLPI 700
>PAL1_SOLTU (P31425) Phenylalanine ammonia-lyase 1 (EC 4.3.1.5)| Length = 720 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 LK WNG PLPIC Sbjct: 709 LKSWNGAPLPIC 720
>PAL2_POPKI (Q43052) Phenylalanine ammonia-lyase G2B (EC 4.3.1.5)| Length = 710 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 LKEW+G PLPIC Sbjct: 699 LKEWDGAPLPIC 710
>PAL1_TOBAC (P25872) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 715 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 LK WNG PLPIC Sbjct: 704 LKSWNGAPLPIC 715
>ATG17_CANGA (Q6FPD4) Autophagy-related protein 17| Length = 409 Score = 28.5 bits (62), Expect = 4.6 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +2 Query: 41 LSHSTLLTYIIKVLLATQHYQVMQLQSLAMHWKLWKNVANINLERLQQKNSIITGAF*NL 220 L L I + L+ T+ QV+ L L KLW + + LERL Q +I+ +L Sbjct: 58 LEQCALRQGIGRALIETEWSQVV-LVDLVNEMKLWYDKIQLRLERLDQVENILVADNKHL 116 Query: 221 KH 226 H Sbjct: 117 SH 118
>PAL1_LYCES (P35511) Phenylalanine ammonia-lyase (EC 4.3.1.5) (PAL)| Length = 704 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 LK WNG PLPIC Sbjct: 693 LKSWNGAPLPIC 704
>PALY_PERAE (P45727) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 620 Score = 28.5 bits (62), Expect = 4.6 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 L+EWNG P+PIC Sbjct: 609 LREWNGAPIPIC 620
>PALY_POPTR (P45730) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 715 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 L EWNG PLPIC Sbjct: 704 LGEWNGSPLPIC 715
>PAL2_PHAVU (P19142) Phenylalanine ammonia-lyase class 2 (EC 4.3.1.5)| (Phenylalanine ammonia-lyase class II) Length = 712 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 L EWNG PLPIC Sbjct: 701 LGEWNGAPLPIC 712
>PAL5_LYCES (P26600) Phenylalanine ammonia-lyase (EC 4.3.1.5) (PAL)| Length = 721 Score = 27.7 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 LK WNG P+PIC Sbjct: 710 LKSWNGAPIPIC 721
>PAL1_PHAVU (P07218) Phenylalanine ammonia-lyase class 1 (EC 4.3.1.5)| (Phenylalanine ammonia-lyase class I) (Fragment) Length = 506 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 L EWNG PLPIC Sbjct: 495 LGEWNGAPLPIC 506
>PALY_TRISU (P45734) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 725 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 L EWNG PLPIC Sbjct: 714 LGEWNGAPLPIC 725
>PALY_MEDSA (P27990) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 725 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 L EWNG PLPIC Sbjct: 714 LGEWNGAPLPIC 725
>PAL1_ARATH (P35510) Phenylalanine ammonia-lyase 1 (EC 4.3.1.5)| Length = 725 Score = 27.7 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -1 Query: 293 LKEWNGEPLPIC 258 L EWNG P+PIC Sbjct: 714 LNEWNGAPIPIC 725 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,199,248 Number of Sequences: 219361 Number of extensions: 641277 Number of successful extensions: 1782 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1782 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
