Clone Name | rbastl13a02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AMPN_CAUCR (P37893) Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoa... | 31 | 0.73 | 2 | RPOM_HUMAN (O00411) DNA-directed RNA polymerase, mitochondrial p... | 31 | 0.95 | 3 | AMPN_ECOLI (P04825) Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoa... | 28 | 8.0 |
---|
>AMPN_CAUCR (P37893) Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoacylpeptide| hydrolase) Length = 863 Score = 31.2 bits (69), Expect = 0.73 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = -2 Query: 244 LAKAQLEMIISANGLSENVYEIASKSL 164 L +AQLE I++ LS+NV E+ASK+L Sbjct: 836 LMRAQLERIVAHPNLSKNVLELASKAL 862
>RPOM_HUMAN (O00411) DNA-directed RNA polymerase, mitochondrial precursor (EC| 2.7.7.6) (MtRPOL) Length = 1230 Score = 30.8 bits (68), Expect = 0.95 Identities = 18/57 (31%), Positives = 25/57 (43%) Frame = +1 Query: 25 TIVACYFTHAKYSRIYSVKYTFGALVMVKGSTGRIKFVSLHQETKLPDFSRLSHRHF 195 T + CY + ++ +T A V V R +FV LH E L D SR + F Sbjct: 1135 TALHCYRKGLTFVSVHDCYWTHAADVSVMNQVCREQFVRLHSEPILQDLSRFLVKRF 1191
>AMPN_ECOLI (P04825) Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoacylpeptide| hydrolase) Length = 869 Score = 27.7 bits (60), Expect = 8.0 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -2 Query: 265 YDETRQALAKAQLEMIISANGLSENVYEIASKSLA 161 YD RQ +A LE + LS ++YE +K+LA Sbjct: 835 YDAKRQEKMRAALEQLKGLENLSGDLYEKITKALA 869 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,277,337 Number of Sequences: 219361 Number of extensions: 585925 Number of successful extensions: 1192 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1192 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)