| Clone Name | rbastl13a01 |
|---|---|
| Clone Library Name | barley_pub |
>MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial)| (High molecular weight salivary mucin MG1) (Sublingual gland mucin) Length = 5703 Score = 30.0 bits (66), Expect = 1.4 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -3 Query: 360 SPRSSYVTAWCSWRTTSGSVWQCPRRPRPKATSLR-LAYITNLPEHTHSWVGSSIFV 193 SP +S+ T CS T SG +WQC P P S++ A+I+ E + G +V Sbjct: 396 SPGTSFNTT-CSSCTCSGGLWQCQDLPCPGTCSVQGGAHISTYDEKLYDLHGDCSYV 451
>ACSA_PASMU (Q9CMW1) Acetyl-coenzyme A synthetase (EC 6.2.1.1) (Acetate--CoA| ligase) (Acyl-activating enzyme) Length = 653 Score = 28.5 bits (62), Expect = 4.2 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = -1 Query: 362 GAQGRPT*RLGAHGGRLPGAFGSAQEGQGLRPLPCVWRTSPICQSILIVGWVRQYSLLCF 183 G+ G+P + + GG L GA S + +P W T+ VGW+ +S +C+ Sbjct: 269 GSTGKPKGIVHSTGGYLLGALNSFRNVFDNKPNDIFWCTAD-------VGWITGHSYVCY 321
>EX1_BUCBP (Q89A43) Exodeoxyribonuclease I (EC 3.1.11.1) (Exonuclease I) (DNA| deoxyribophosphodiesterase) (dRPase) Length = 481 Score = 27.7 bits (60), Expect = 7.2 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -1 Query: 242 PICQSILIVGWVRQYSLLCFVTEFEFQ*TNYTFVVHLKDCII 117 P +S+LI G +Y+ L V EFEF Y+ + CII Sbjct: 59 PDPESVLITGISPKYTSLFGVNEFEFAKKIYSLFMKSDTCII 100
>IGF1R_XENLA (O73798) Insulin-like growth factor 1 receptor precursor (EC| 2.7.10.1) (xIGF-1R) (xIGFR) [Contains: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain] Length = 1358 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 108 YIQGLAVCITPAFCGTCGPNV 46 +I GL +C+ PA CGPN+ Sbjct: 12 WILGLLLCLGPAAAKVCGPNM 32
>YKW2_YEAST (P35995) Putative 82.2 kDa transcriptional regulatory protein in| FRE2 5'region Length = 705 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -3 Query: 270 ATSLRLAYITNLPEHTHSWVGSSIFVAVFRYGI*VPINQLHLCRSLERLYY 118 AT + ++NL TH +F + + P+N LHLC ++ Y+ Sbjct: 463 ATLHMIGSLSNLYTLTHQ----DFDARIFNFSVLAPLNSLHLCFNVLETYF 509
>RECO_CHLMU (Q9PJS3) DNA repair protein recO (Recombination protein O)| Length = 234 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 300 WQCPRRPRPKATSLRLAYITNLPEHTHSWVGSSIFV 193 WQ +P P+ SL L ++ +PE H + SS+F+ Sbjct: 103 WQ--EKPSPQLFSLFLNFLQRIPETPHPYFFSSMFL 136 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,465,435 Number of Sequences: 219361 Number of extensions: 1090098 Number of successful extensions: 2401 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2400 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)