Clone Name | rbastl12h10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MRAW_THEFY (Q47QX7) S-adenosyl-methyltransferase mraW (EC 2.1.1.-) | 28 | 7.6 | 2 | AGUA_STRR6 (Q8DQ68) Putative agmatine deiminase (EC 3.5.3.12) (A... | 27 | 10.0 | 3 | AGUA_STRPN (Q97RA4) Putative agmatine deiminase (EC 3.5.3.12) (A... | 27 | 10.0 |
---|
>MRAW_THEFY (Q47QX7) S-adenosyl-methyltransferase mraW (EC 2.1.1.-)| Length = 330 Score = 27.7 bits (60), Expect = 7.6 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 6/95 (6%) Frame = +2 Query: 29 LSSLKVETKHGYHHKVKVTTL*LDESEIGFLAHPQRFSYGV-LQTSMSVLQLQVDAD*FD 205 L L ++ HG + V++ LDE+E GF +SY L M Q + AD + Sbjct: 104 LDELGIDRVHGLLFDLGVSSPQLDEAERGF-----AYSYDAPLDMRMDRTQERTAADIVN 158 Query: 206 CFHRTEI-----LFQDTRMAIKIAALIFLHYARRP 295 + +E+ ++ + R A +IA I A+ P Sbjct: 159 TYPASELTRIFRVYGEERFAARIAQAIVRQRAKEP 193
>AGUA_STRR6 (Q8DQ68) Putative agmatine deiminase (EC 3.5.3.12) (Agmatine| iminohydrolase) Length = 361 Score = 27.3 bits (59), Expect = 10.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 251 WPFSYPGIIFLCDENNQINQRRLEAVERSCWSVKP 147 W +Y G+ +E++Q+ R EA+ER + KP Sbjct: 114 WGGTYDGLYQDYEEDDQVASRFAEALERPVYDAKP 148
>AGUA_STRPN (Q97RA4) Putative agmatine deiminase (EC 3.5.3.12) (Agmatine| iminohydrolase) Length = 361 Score = 27.3 bits (59), Expect = 10.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 251 WPFSYPGIIFLCDENNQINQRRLEAVERSCWSVKP 147 W +Y G+ +E++Q+ R EA+ER + KP Sbjct: 114 WGGTYDGLYQDYEEDDQVASRFAEALERPVYDAKP 148 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.135 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,483,611 Number of Sequences: 219361 Number of extensions: 763527 Number of successful extensions: 1495 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1469 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1495 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)