Clone Name | rbastl12h04 |
---|---|
Clone Library Name | barley_pub |
>LAT3_HUMAN (O75387) Large neutral amino acids transporter small subunit 3| (L-type amino acid transporter 3) (Solute carrier family 43 member 1) (Prostate cancer overexpressed gene 1 protein) Length = 559 Score = 30.0 bits (66), Expect = 1.7 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 121 MFGESQYSCIMCCPLLSYIPDYAV 50 +FG Q C++ CPL+ YI D+ + Sbjct: 358 VFGAMQLLCLLTCPLIGYIMDWRI 381
>LAT3_MOUSE (Q8BSM7) Large neutral amino acids transporter small subunit 3| (L-type amino acid transporter 3) (Solute carrier family 43 member 1) Length = 564 Score = 29.6 bits (65), Expect = 2.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 121 MFGESQYSCIMCCPLLSYIPDYAV 50 +FG Q C++ CPL+ YI D+ + Sbjct: 358 IFGVMQLLCLLTCPLIGYIMDWRI 381
>S40A1_HUMAN (Q9NP59) Solute carrier family 40 member 1 (Ferroportin-1)| (Iron-regulated transporter 1) Length = 571 Score = 28.5 bits (62), Expect = 4.9 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = -2 Query: 211 LVSGSTVT*ICLLRT*IFEW--RLCTIFQLCLMFGESQYSCIMCCPLLSYIPDYAVSLS 41 L+ S +T I + T F W R C + + L+ G +Q SC++ C + ++P + LS Sbjct: 345 LMGASAITGI--MGTVAFTWLRRKCGLVRTGLISGLAQLSCLILCVISVFMPGSPLDLS 401
>S40A1_RAT (Q923U9) Solute carrier family 40 member 1 (Ferroportin-1) (Cell| adhesion regulator) (CAR1) Length = 570 Score = 28.1 bits (61), Expect = 6.4 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = -2 Query: 211 LVSGSTVT*ICLLRT*IFEW--RLCTIFQLCLMFGESQYSCIMCCPLLSYIPDYAVSLS 41 L+ S +T I + T F W R C + + L G +Q SC++ C + ++P + LS Sbjct: 345 LMGASAITGI--MGTVAFTWLRRKCGLVRTGLFSGLAQLSCLILCVISVFMPGSPLDLS 401
>S40A1_MOUSE (Q9JHI9) Solute carrier family 40 member 1 (Ferroportin-1)| (Iron-regulated transporter 1) (Metal transporter protein 1) (MTP1) Length = 570 Score = 28.1 bits (61), Expect = 6.4 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = -2 Query: 211 LVSGSTVT*ICLLRT*IFEW--RLCTIFQLCLMFGESQYSCIMCCPLLSYIPDYAVSLS 41 L+ S +T I + T F W R C + + L G +Q SC++ C + ++P + LS Sbjct: 345 LMGASAITGI--MGTVAFTWLRRKCGLVRTGLFSGLAQLSCLILCVISVFMPGSPLDLS 401
>HIS81_GLUOX (Q5FRR4) Histidinol-phosphate aminotransferase 1 (EC 2.6.1.9)| (Imidazole acetol-phosphate transaminase 1) Length = 401 Score = 27.7 bits (60), Expect = 8.4 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 13/48 (27%) Frame = -2 Query: 127 CLMFGESQYSCIMCCPLLSYI-------------PDYAVSLSSMHNES 23 CLM G++ S I CP + I PDYA SL+ + N+S Sbjct: 197 CLMTGDAMQSLIDACPADTLIVIDEAYWEYARSSPDYADSLTILKNQS 244 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,956,391 Number of Sequences: 219361 Number of extensions: 538952 Number of successful extensions: 1134 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1098 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1133 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)